SRPR antibody
-
- Target See all SRPR Antibodies
- SRPR (Signal Recognition Particle Receptor (Docking Protein) (SRPR))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SRPR antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SRPR antibody was raised using a synthetic peptide corresponding to a region with amino acids EEFIQKHGRGMEKSNKSTKSDAPKEKGKKAPRVWELGGCANKEVLDYSTP
- Top Product
- Discover our top product SRPR Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SRPR Blocking Peptide, catalog no. 33R-2356, is also available for use as a blocking control in assays to test for specificity of this SRPR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRPR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SRPR (Signal Recognition Particle Receptor (Docking Protein) (SRPR))
- Alternative Name
- SRPR (SRPR Products)
- Synonyms
- sralpha antibody, srp-alpha antibody, 1300011P19Rik antibody, D11Mgi27 antibody, DP antibody, Sralpha antibody, SRP receptor alpha subunit antibody, signal recognition particle receptor (docking protein) antibody, signal recognition particle receptor subunit alpha antibody, signal recognition particle receptor antibody, signal recognition particle receptor (Docking protein) antibody, signal recognition particle receptor ('docking protein') antibody, srpra antibody, ftsY antibody, Tb11.01.1650 antibody, STER_1399 antibody, CMU_011790 antibody, EUBELI_01057 antibody, MGYG_00278 antibody, Tsp_06333 antibody, Srpr antibody, Srpra antibody, SRPRA antibody
- Background
- SRPR belongs to the GTP-binding SRP family. It is in conjunction with SRP, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system.
- Molecular Weight
- 70 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-