CACNB3 antibody (N-Term)
-
- Target See all CACNB3 Antibodies
- CACNB3 (Calcium Channel, Voltage-Dependent, beta 3 Subunit (CACNB3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CACNB3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CACNB3 antibody was raised against the n terminal of CACNB3
- Purification
- Affinity purified
- Immunogen
- CACNB3 antibody was raised using the N terminal of CACNB3 corresponding to a region with amino acids MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQ
- Top Product
- Discover our top product CACNB3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CACNB3 Blocking Peptide, catalog no. 33R-6623, is also available for use as a blocking control in assays to test for specificity of this CACNB3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNB3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CACNB3 (Calcium Channel, Voltage-Dependent, beta 3 Subunit (CACNB3))
- Alternative Name
- CACNB3 (CACNB3 Products)
- Synonyms
- vgcc antibody, xo28 antibody, xo32 antibody, o32-a antibody, cacnlb3 antibody, VGCC antibody, CACNB3 antibody, CAB3 antibody, CACNLB3 antibody, Beta3 antibody, Cchb3 antibody, CACH3B antibody, cacnb3 antibody, Cacnb3 antibody, calcium channel, voltage-dependent, beta 3 subunit S homeolog antibody, calcium channel, voltage-dependent, beta 3 subunit L homeolog antibody, calcium voltage-gated channel auxiliary subunit beta 3 antibody, calcium channel, voltage-dependent, beta 3b antibody, calcium channel, voltage-dependent, beta 3 subunit antibody, calcium channel, voltage-dependent, beta 3a antibody, cacnb3.S antibody, cacnb3.L antibody, CACNB3 antibody, cacnb3b antibody, cacnb3 antibody, Cacnb3 antibody, cacnb3a antibody
- Background
- The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
- Molecular Weight
- 49 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction
-