TRPM8 antibody (N-Term)

Catalog No. ABIN633722

Product Details anti-TRPM8 Antibody

Target: TRPM8 (Transient Receptor Potential Cation Channel, Subfamily M, Member 8 (TRPM8))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRPM8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRPM8 antibody was raised against the N terminal of TRPM8

Purification: Affinity purified

Immunogen: TRPM8 antibody was raised using the N terminal of TRPM8 corresponding to a region with amino acids YILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRPM8 Blocking Peptide, catalog no. 33R-10139, is also available for use as a blocking control in assays to test for specificity of this TRPM8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRPM8

Target: TRPM8 (Transient Receptor Potential Cation Channel, Subfamily M, Member 8 (TRPM8))

Alternative Name: TRPM8 (TRPM8 Products)

Synonyms: TRPM8 antibody, trpp8 antibody, ltrpc6 antibody, trpm8b antibody, LTRPC6 antibody, TRPP8 antibody, CMR1 antibody, LTrpC-6 antibody, Trp-p8 antibody, transient receptor potential cation channel subfamily M member 8 antibody, transient receptor potential cation channel subfamily M member 8b L homeolog antibody, transient receptor potential cation channel, subfamily M, member 8 antibody, TRPM8 antibody, trpm8b.L antibody, Trpm8 antibody

Background: TRPM8 is the receptor-activated non-selective cation channel involved in detection of sensations such as coolness, by being activated by cold temperature below 25 degrees Celsius. TRPM8 is activated by icilin, eucalyptol, menthol, cold and modulation of intracellular pH. TRPM8 is involved in menthol sensation. TRPM8 is permeable for monovalent cations sodium, potassium, and cesium and divalent cation calcium. Temperature sensing is tightly linked to voltage-dependent gating. TRPM8 was activated upon depolarization, changes in temperature resulting in graded shifts of its voltage-dependent activation curves. The chemical agonists menthol functions as a gating modifier, shifting activation curves towards physiological membrane potentials. Temperature sensitivity arises from a tenfold difference in the activation energies associated with voltage-dependent opening and closing.

Molecular Weight: 128 kDa (MW of target protein)