P2RX2 antibody (N-Term)
-
- Target See all P2RX2 Antibodies
- P2RX2 (Purinergic Receptor P2X, Ligand Gated Ion Channel 2 (P2RX2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This P2RX2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- P2 RX2 antibody was raised against the N terminal of P2 X2
- Purification
- Affinity purified
- Immunogen
- P2 RX2 antibody was raised using the N terminal of P2 X2 corresponding to a region with amino acids YFVWYVFIVQKSYQESETGPESSIITKVKGITTSEHKVWDVEEYVKPPEG
- Top Product
- Discover our top product P2RX2 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
P2RX2 Blocking Peptide, catalog no. 33R-10100, is also available for use as a blocking control in assays to test for specificity of this P2RX2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 X2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- P2RX2 (Purinergic Receptor P2X, Ligand Gated Ion Channel 2 (P2RX2))
- Alternative Name
- P2RX2 (P2RX2 Products)
- Synonyms
- DFNA41 antibody, P2X2 antibody, P2X2a antibody, P2x2 antibody, p2xr2 antibody, P2RX2 antibody, purinergic receptor P2X 2 antibody, purinergic receptor P2X, ligand-gated ion channel, 2 antibody, P2RX2 antibody, P2rx2 antibody, p2rx2 antibody
- Background
- The product of P2RX2 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle.
- Molecular Weight
- 52 kDa (MW of target protein)
- Pathways
- Skeletal Muscle Fiber Development, Positive Regulation of Endopeptidase Activity
-