NR2E1 antibody (Middle Region)
-
- Target See all NR2E1 Antibodies
- NR2E1 (Nuclear Receptor Subfamily 2, Group E, Member 1 (NR2E1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NR2E1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NR2 E1 antibody was raised against the middle region of NR2 1
- Purification
- Affinity purified
- Immunogen
- NR2 E1 antibody was raised using the middle region of NR2 1 corresponding to a region with amino acids LAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLL
- Top Product
- Discover our top product NR2E1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NR2E1 Blocking Peptide, catalog no. 33R-4758, is also available for use as a blocking control in assays to test for specificity of this NR2E1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NR2E1 (Nuclear Receptor Subfamily 2, Group E, Member 1 (NR2E1))
- Alternative Name
- NR2E1 (NR2E1 Products)
- Synonyms
- NR2E1 antibody, TLL antibody, TLX antibody, XTLL antibody, Mtl1 antibody, Mtll antibody, Tlx antibody, fierce antibody, frc antibody, tailless antibody, fc30e03 antibody, fc39f12 antibody, wu:fc30e03 antibody, wu:fc39f12 antibody, zgc:100991 antibody, Xtll antibody, nr2e1-A antibody, tlx antibody, nuclear receptor subfamily 2 group E member 1 antibody, nuclear receptor subfamily 2, group E, member 1 antibody, nuclear receptor subfamily 2 group E member 1 S homeolog antibody, NR2E1 antibody, Nr2e1 antibody, nr2e1 antibody, nr2e1.S antibody
- Background
- The NR2E1 gene is a member of the steroid nuclear receptor superfamily and is predominately expressed in the brain. The contributions of this gene to human B-cell leukemia and to brain development are unknown at present.
- Molecular Weight
- 42 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Stem Cell Maintenance
-