GSTM1 antibody (N-Term)

Catalog No. ABIN633921

Product Details anti-GSTM1 Antibody

Target: GSTM1 (Glutathione S-Transferase mu 1 (GSTM1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GSTM1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GSTM1 antibody was raised against the N terminal of GSTM1

Purification: Affinity purified

Immunogen: GSTM1 antibody was raised using the N terminal of GSTM1 corresponding to a region with amino acids KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GSTM1 Blocking Peptide, catalog no. 33R-4498, is also available for use as a blocking control in assays to test for specificity of this GSTM1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GSTM1

Target: GSTM1 (Glutathione S-Transferase mu 1 (GSTM1))

Alternative Name: GSTM1 (GSTM1 Products)

Synonyms: GST1 antibody, GSTM1-1 antibody, GSTM1a-1a antibody, GSTM1b-1b antibody, GTH4 antibody, GTM1 antibody, H-B antibody, MU antibody, MU-1 antibody, GSTA3 antibody, Gstb-1 antibody, Gstb1 antibody, gst-mu antibody, gst1 antibody, gstm1 antibody, gstm2 antibody, gth4 antibody, gtm1 antibody, glutathione S-transferase mu 1 antibody, glutathione S-transferase M1 antibody, glutathione S-transferase, mu 1 antibody, glutathione S-transferase Mu 1 antibody, glutathione S-transferase mu 2 (muscle) antibody, glutathione S-transferase mu 1 L homeolog antibody, GSTM1 antibody, Gstm1 antibody, LOC100356307 antibody, GSTM2 antibody, LOC100731426 antibody, gstm1.L antibody

Background: Cytosolic and membrane-bound forms of glutathione S-transferase are two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. GSTM1 a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione.

Molecular Weight: 24 kDa (MW of target protein)

Pathways: Negative Regulation of Transporter Activity