LOXL1 antibody (Middle Region)
-
- Target See all LOXL1 Antibodies
- LOXL1 (Lysyl Oxidase-Like 1 (LOXL1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LOXL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LOXL1 antibody was raised against the middle region of LOXL1
- Purification
- Affinity purified
- Immunogen
- LOXL1 antibody was raised using the middle region of LOXL1 corresponding to a region with amino acids YRPNQNGRGLPDLVPDPNYVQASTYVQRAHLYSLRCAAEEKCLASTAYAP
- Top Product
- Discover our top product LOXL1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LOXL1 Blocking Peptide, catalog no. 33R-10229, is also available for use as a blocking control in assays to test for specificity of this LOXL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOXL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LOXL1 (Lysyl Oxidase-Like 1 (LOXL1))
- Alternative Name
- LOXL1 (LOXL1 Products)
- Synonyms
- LOL antibody, LOXL antibody, Loxl antibody, si:ch211-238c15.1 antibody, lol antibody, loxl antibody, loxl-1 antibody, oxl-1 antibody, lysyl oxidase like 1 antibody, lysyl oxidase-like 1 antibody, lysyl oxidase like 1 L homeolog antibody, LOXL1 antibody, loxl1 antibody, Loxl1 antibody, loxl1.L antibody
- Background
- LOXL1 is a member of the lysyl oxidase family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function.
- Molecular Weight
- 53 kDa (MW of target protein)
-