POLK antibody
-
- Target See all POLK Antibodies
- POLK (Polymerase (DNA Directed) kappa (POLK))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This POLK antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- POLK antibody was raised using a synthetic peptide corresponding to a region with amino acids ATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQ
- Top Product
- Discover our top product POLK Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
POLK Blocking Peptide, catalog no. 33R-1553, is also available for use as a blocking control in assays to test for specificity of this POLK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- POLK (Polymerase (DNA Directed) kappa (POLK))
- Alternative Name
- POLK (POLK Products)
- Synonyms
- DINB1 antibody, DINP antibody, POLQ antibody, Dinb1 antibody, POLK antibody, si:ch211-254o18.3 antibody, DNA polymerase kappa antibody, polymerase (DNA directed) kappa antibody, polymerase (DNA directed), kappa antibody, polymerase (DNA directed) kappa L homeolog antibody, POLK antibody, Polk antibody, polk antibody, Tb11.01.0080 antibody, Tb11.01.0010 antibody, Tb11.01.0020 antibody, Tb11.01.0030 antibody, Tb11.01.0040 antibody, Tb11.01.0050 antibody, Tb11.12.0001 antibody, Tb11.12.0002 antibody, Tb11.12.0003 antibody, polk.L antibody, polk-1 antibody
- Background
- POLK belongs to the DNA polymerase type-Y family. It contains 2 Rad18-type zinc fingers and 1 umuC domain. POLK is a DNA polymerase specifically involved in DNA repair. It plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls.
- Molecular Weight
- 99 kDa (MW of target protein)
- Pathways
- DNA Damage Repair
-