POLK antibody

Catalog No. ABIN634096

This Rabbit Polyclonal antibody specifically detects POLK in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for POLK antibody (ABIN634096)

Target: POLK (Polymerase (DNA Directed) kappa (POLK))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POLK antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-POLK Antibody

Purification: Affinity purified

Immunogen: POLK antibody was raised using a synthetic peptide corresponding to a region with amino acids ATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POLK Blocking Peptide, (ABIN936939), is also available for use as a blocking control in assays to test for specificity of this POLK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for POLK

Target: POLK (Polymerase (DNA Directed) kappa (POLK))

Alternative Name: POLK

Background: POLK belongs to the DNA polymerase type-Y family. It contains 2 Rad18-type zinc fingers and 1 umuC domain. POLK is a DNA polymerase specifically involved in DNA repair. It plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls.

Molecular Weight: 99 kDa (MW of target protein)

Pathways: DNA Damage Repair