POLB antibody

Catalog No. ABIN634154

Product Details anti-POLB Antibody

Target: POLB (Polymerase (DNA Directed), beta (POLB))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POLB antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: POLB antibody was raised using a synthetic peptide corresponding to a region with amino acids GPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEML

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POLB Blocking Peptide, catalog no. 33R-3482, is also available for use as a blocking control in assays to test for specificity of this POLB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for POLB

Target: POLB (Polymerase (DNA Directed), beta (POLB))

Alternative Name: POLB (POLB Products)

Synonyms: wu:fa97a05 antibody, zgc:109924 antibody, POLB antibody, DDBDRAFT_0186152 antibody, DDBDRAFT_0215784 antibody, DDBDRAFT_0232376 antibody, DDB_0186152 antibody, DDB_0215784 antibody, DDB_0232376 antibody, A430088C08Rik antibody, polymerase (DNA directed), beta antibody, DNA polymerase beta antibody, DNA polymerase X family protein antibody, polymerase (DNA directed), beta S homeolog antibody, polb antibody, POLB antibody, polB antibody, polb.S antibody, Polb antibody

Background: In eukaryotic cells, DNA polymerase beta (POLB) performs base excision repair (BER) required for DNA maintenance, replication, recombination, and drug resistance.

Molecular Weight: 38 kDa (MW of target protein)

Pathways: DNA Damage Repair