SPO11 antibody
-
- Target See all SPO11 Antibodies
- SPO11 (SPO11 Meiotic Protein Covalently Bound To DSB Homolog (SPO11))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SPO11 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SPO11 antibody was raised using a synthetic peptide corresponding to a region with amino acids KFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISC
- Top Product
- Discover our top product SPO11 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SPO11 Blocking Peptide, catalog no. 33R-4380, is also available for use as a blocking control in assays to test for specificity of this SPO11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPO11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPO11 (SPO11 Meiotic Protein Covalently Bound To DSB Homolog (SPO11))
- Alternative Name
- SPO11 (SPO11 Products)
- Synonyms
- CT35 antibody, SPATA43 antibody, TOPVIA antibody, zgc:77876 antibody, AI449549 antibody, Meiotic recombination protein spo-11 antibody, SPO11, initiator of meiotic double stranded breaks antibody, SPO11 meiotic protein covalently bound to DSB antibody, spo-11 antibody, SPO11 antibody, Spo11 antibody, spo11 antibody
- Background
- Meiotic recombination and chromosome segregation require the formation of double-strand breaks (DSBs) in paired chromosome homologs. During meiosis in yeast, a meiotic recombination protein is covalently-linked to the 5' end of DSBs and is essential for the formation of DSBs. SPO11 is similar in sequence and conserved features to the yeast meiotic recombination protein. It belongs to the TOP6A protein family.
- Molecular Weight
- 44 kDa (MW of target protein)
-