LIG1 antibody (Middle Region)
-
- Target See all LIG1 Antibodies
- LIG1 (Ligase I, DNA, ATP-Dependent (LIG1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LIG1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LIG1 antibody was raised against the middle region of LIG1
- Purification
- Affinity purified
- Immunogen
- LIG1 antibody was raised using the middle region of LIG1 corresponding to a region with amino acids PSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF
- Top Product
- Discover our top product LIG1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LIG1 Blocking Peptide, catalog no. 33R-7379, is also available for use as a blocking control in assays to test for specificity of this LIG1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIG1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LIG1 (Ligase I, DNA, ATP-Dependent (LIG1))
- Alternative Name
- LIG1 (LIG1 Products)
- Synonyms
- ATLIG1 antibody, DNA ligase 1 antibody, T6D22.23 antibody, ligI antibody, AL033288 antibody, LigI antibody, lig1 antibody, wu:fc54a11 antibody, DNA ligase 1 antibody, DNA ligase 1, putative antibody, ligase I, DNA, ATP-dependent L homeolog antibody, ligase I, DNA, ATP-dependent antibody, LIG1 antibody, PB000674.02.0 antibody, PTRG_06243 antibody, PKH_140260 antibody, lig1.L antibody, Lig1 antibody, lig-1 antibody, lig1 antibody
- Background
- LIG1 encodes DNA ligase I, with functions in DNA replication and the base excision repair process. Mutations in LIG1 that lead to DNA ligase I deficiency result in immunodeficiency and increased sensitivity to DNA-damaging agents.
- Molecular Weight
- 102 kDa (MW of target protein)
- Pathways
- Telomere Maintenance, DNA Damage Repair, DNA Replication, Synthesis of DNA
-