LIG1 antibody (Middle Region)

Catalog No. ABIN634194

Product Details anti-LIG1 Antibody

Target: LIG1 (Ligase I, DNA, ATP-Dependent (LIG1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LIG1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LIG1 antibody was raised against the middle region of LIG1

Purification: Affinity purified

Immunogen: LIG1 antibody was raised using the middle region of LIG1 corresponding to a region with amino acids ALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LIG1 Blocking Peptide, catalog no. 33R-1328, is also available for use as a blocking control in assays to test for specificity of this LIG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LIG1

Target: LIG1 (Ligase I, DNA, ATP-Dependent (LIG1))

Alternative Name: LIG1 (LIG1 Products)

Synonyms: ATLIG1 antibody, DNA ligase 1 antibody, T6D22.23 antibody, ligI antibody, AL033288 antibody, LigI antibody, lig1 antibody, wu:fc54a11 antibody, DNA ligase 1 antibody, DNA ligase 1, putative antibody, ligase I, DNA, ATP-dependent L homeolog antibody, ligase I, DNA, ATP-dependent antibody, LIG1 antibody, PB000674.02.0 antibody, PTRG_06243 antibody, PKH_140260 antibody, lig1.L antibody, Lig1 antibody, lig-1 antibody, lig1 antibody

Background: LIG1 encodes DNA ligase I, with functions in DNA replication and the base excision repair process. Mutations in LIG1 that lead to DNA ligase I deficiency result in immunodeficiency and increased sensitivity to DNA-damaging agents.

Molecular Weight: 102 kDa (MW of target protein)

Pathways: Telomere Maintenance, DNA Damage Repair, DNA Replication, Synthesis of DNA