MAPK13 antibody (Middle Region)

Catalog No. ABIN634241

Product Details anti-MAPK13 Antibody

Target: MAPK13 (Mitogen-Activated Protein Kinase 13 (MAPK13))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAPK13 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MAPK13 antibody was raised against the middle region of MAPK13

Purification: Affinity purified

Immunogen: MAPK13 antibody was raised using the middle region of MAPK13 corresponding to a region with amino acids KMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAPK13 Blocking Peptide, catalog no. 33R-4558, is also available for use as a blocking control in assays to test for specificity of this MAPK13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPK13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAPK13

Target: MAPK13 (Mitogen-Activated Protein Kinase 13 (MAPK13))

Alternative Name: MAPK13 (MAPK13 Products)

Synonyms: F24B9.3 antibody, F24B9_3 antibody, MAPK 13 antibody, MAPK-13 antibody, PRKM13 antibody, SAPK4 antibody, p38delta antibody, Serk4 antibody, Prkm13 antibody, sapk4 antibody, prkm13 antibody, Protein kinase superfamily protein antibody, mitogen-activated protein kinase 13 antibody, mitogen activated protein kinase 13 antibody, ATMPK13 antibody, MAPK13 antibody, Mapk13 antibody, mapk13 antibody

Background: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation and transcription.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: MAPK Signaling, Neurotrophin Signaling Pathway, Hepatitis C, BCR Signaling, S100 Proteins