MAPK13 antibody (Middle Region)
-
- Target See all MAPK13 Antibodies
- MAPK13 (Mitogen-Activated Protein Kinase 13 (MAPK13))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MAPK13 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MAPK13 antibody was raised against the middle region of MAPK13
- Purification
- Affinity purified
- Immunogen
- MAPK13 antibody was raised using the middle region of MAPK13 corresponding to a region with amino acids KMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVD
- Top Product
- Discover our top product MAPK13 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MAPK13 Blocking Peptide, catalog no. 33R-4558, is also available for use as a blocking control in assays to test for specificity of this MAPK13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPK13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAPK13 (Mitogen-Activated Protein Kinase 13 (MAPK13))
- Alternative Name
- MAPK13 (MAPK13 Products)
- Synonyms
- F24B9.3 antibody, F24B9_3 antibody, MAPK 13 antibody, MAPK-13 antibody, PRKM13 antibody, SAPK4 antibody, p38delta antibody, Serk4 antibody, Prkm13 antibody, sapk4 antibody, prkm13 antibody, Protein kinase superfamily protein antibody, mitogen-activated protein kinase 13 antibody, mitogen activated protein kinase 13 antibody, ATMPK13 antibody, MAPK13 antibody, Mapk13 antibody, mapk13 antibody
- Background
- The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation and transcription.
- Molecular Weight
- 42 kDa (MW of target protein)
- Pathways
- MAPK Signaling, Neurotrophin Signaling Pathway, Hepatitis C, BCR Signaling, S100 Proteins
-