COL4a3 antibody

Catalog No. ABIN634306

Product Details anti-COL4a3 Antibody

Target: COL4a3 (COL4A3) (Collagen, Type IV, alpha 3 (COL4A3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This COL4a3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Collagen Type IV alpha 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Collagen Type IV alpha 3 Blocking Peptide, catalog no. 33R-7287, is also available for use as a blocking control in assays to test for specificity of this Collagen Type IV alpha 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COL0 0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for COL4a3

Target: COL4a3 (COL4A3) (Collagen, Type IV, alpha 3 (COL4A3))

Alternative Name: Collagen Type IV alpha 3 (COL4A3 Products)

Synonyms: zTumstatin antibody, [a]3(IV) antibody, alpha3(IV) antibody, collagen type IV alpha 3 chain antibody, collagen, type IV, alpha 3 antibody, COL4A3 antibody, col4a3 antibody, Col4a3 antibody

Background: This gene encodes a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen. Goodpasture disease is the result of an autoimmune response directed at this antigen. One isoform of this protein is also involved in ceramide intracellular transport. Two transcripts exist for this gene.

Molecular Weight: 68 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Positive Regulation of Endopeptidase Activity