NCF4 antibody (N-Term)

Catalog No. ABIN634325

The Rabbit Polyclonal anti-NCF4 antibody has been validated for WB. It is suitable to detect NCF4 in samples from Human.

Quick Overview for NCF4 antibody (N-Term) (ABIN634325)

Target: NCF4 (Neutrophil Cytosolic Factor 4, 40kDa (NCF4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NCF4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NCF4 Antibody

Binding Specificity: N-Term

Specificity: NCF4 antibody was raised against the N terminal of NCF4

Purification: Affinity purified

Immunogen: NCF4 antibody was raised using the N terminal of NCF4 corresponding to a region with amino acids SKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQE

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NCF4 Blocking Peptide, (ABIN5614929), is also available for use as a blocking control in assays to test for specificity of this NCF4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NCF4

Target: NCF4 (Neutrophil Cytosolic Factor 4, 40kDa (NCF4))

Alternative Name: NCF4

Background: NCF4 is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling event.

Molecular Weight: 39 kDa (MW of target protein)