MAP3K2 antibody (N-Term)

Catalog No. ABIN634340

Product Details anti-MAP3K2 Antibody

Target: MAP3K2 (Mitogen-Activated Protein Kinase Kinase Kinase 2 (MAP3K2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAP3K2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MAP3 K2 antibody was raised against the N terminal of MAP3 2

Purification: Affinity purified

Immunogen: MAP3 K2 antibody was raised using the N terminal of MAP3 2 corresponding to a region with amino acids AERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAP3K2 Blocking Peptide, catalog no. 33R-1147, is also available for use as a blocking control in assays to test for specificity of this MAP3K2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAP3K2

Target: MAP3K2 (Mitogen-Activated Protein Kinase Kinase Kinase 2 (MAP3K2))

Alternative Name: MAP3K2 (MAP3K2 Products)

Synonyms: Mekk2 antibody, MEKK2 antibody, MEKK2B antibody, 9630061B06Rik antibody, AI585793 antibody, Mekk2b antibody, mitogen activated protein kinase kinase kinase 2 antibody, mitogen-activated protein kinase kinase kinase 2 antibody, Map3k2 antibody, MAP3K2 antibody

Background: MAP3K2 is a component of a protein kinase signal transduction cascade. It regulates the JNK and ERK5 pathways by phosphorylating and activating MAP2K5 and MAP2K7. It also plays a role in caveolae kiss-and-run dynamics.

Molecular Weight: 70 kDa (MW of target protein)

Pathways: MAPK Signaling