RHEB antibody (Middle Region)
-
- Target See all RHEB Antibodies
- RHEB (Ras Homolog Enriched in Brain (RHEB))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RHEB antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RHEB antibody was raised against the middle region of RHEB
- Purification
- Affinity purified
- Immunogen
- RHEB antibody was raised using the middle region of RHEB corresponding to a region with amino acids VGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTA
- Top Product
- Discover our top product RHEB Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RHEB Blocking Peptide, catalog no. 33R-9564, is also available for use as a blocking control in assays to test for specificity of this RHEB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHEB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RHEB (Ras Homolog Enriched in Brain (RHEB))
- Alternative Name
- RHEB (RHEB Products)
- Synonyms
- RHEB2 antibody, RHEB antibody, rheb2 antibody, CG1081 antibody, DReb antibody, Dm Rheb antibody, DmRheb antibody, Dmel\CG1081 antibody, Q9VND8 antibody, RheB antibody, dRheb antibody, rheb antibody, Ras homolog, mTORC1 binding antibody, Ras homolog enriched in brain antibody, ras homolog enriched in brain antibody, Ras homolog, mTORC1 binding L homeolog antibody, RHEB antibody, Rheb antibody, rheb antibody, rheb.L antibody
- Background
- This gene is a member of the small GTPase superfamily and encodes a lipid-anchored, cell membrane protein with five repeats of the RAS-related GTP-binding region.
- Molecular Weight
- 20 kDa (MW of target protein)
- Pathways
- RTK Signaling
-