PRKAA1 antibody (Middle Region)
-
- Target See all PRKAA1 Antibodies
- PRKAA1 (Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit (PRKAA1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRKAA1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PRKAA1 antibody was raised against the middle region of PRKAA1
- Purification
- Affinity purified
- Immunogen
- PRKAA1 antibody was raised using the middle region of PRKAA1 corresponding to a region with amino acids SVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
- Top Product
- Discover our top product PRKAA1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRKAA1 Blocking Peptide, catalog no. 33R-8915, is also available for use as a blocking control in assays to test for specificity of this PRKAA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKAA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRKAA1 (Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit (PRKAA1))
- Alternative Name
- PRKAA1 (PRKAA1 Products)
- Synonyms
- AMPK antibody, AMPKa1 antibody, cb116 antibody, im:7154392 antibody, sb:cb130 antibody, wu:fa94c10 antibody, AMPK1 antibody, AMPKalpha1 antibody, AI194361 antibody, AI450832 antibody, AL024255 antibody, C130083N04Rik antibody, ampk antibody, ampka1 antibody, PRKAA1 antibody, protein kinase AMP-activated catalytic subunit alpha 1 antibody, protein kinase, AMP-activated, alpha 1 catalytic subunit antibody, protein kinase, AMP-activated, alpha 1 catalytic subunit L homeolog antibody, PRKAA1 antibody, prkaa1 antibody, Prkaa1 antibody, prkaa1.L antibody
- Background
- PRKAA1 belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK).
- Molecular Weight
- 63 kDa (MW of target protein)
- Pathways
- AMPK Signaling, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Warburg Effect
-