PPP2R1B antibody
-
- Target See all PPP2R1B Antibodies
- PPP2R1B (Protein Phosphatase 2, Regulatory Subunit A, beta (PPP2R1B))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPP2R1B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PPP2 R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQ
- Top Product
- Discover our top product PPP2R1B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPP2R1B Blocking Peptide, catalog no. 33R-2332, is also available for use as a blocking control in assays to test for specificity of this PPP2R1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPP2R1B (Protein Phosphatase 2, Regulatory Subunit A, beta (PPP2R1B))
- Alternative Name
- PPP2R1B (PPP2R1B Products)
- Synonyms
- 2410091N08Rik antibody, AI790395 antibody, PP2A-Abeta antibody, PR65B antibody, protein phosphatase 2, regulatory subunit A, beta antibody, protein phosphatase 2 scaffold subunit Abeta antibody, protein phosphatase 2 scaffold subunit A beta antibody, protein phosphatase 2 regulatory subunit A, beta S homeolog antibody, Ppp2r1b antibody, PPP2R1B antibody, ppp2r1b.S antibody
- Background
- This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division.
- Molecular Weight
- 73 kDa (MW of target protein)
- Pathways
- PI3K-Akt Signaling, Mitotic G1-G1/S Phases, Hepatitis C, Toll-Like Receptors Cascades
-