Connexin 43/GJA1 antibody (N-Term)
-
- Target See all Connexin 43/GJA1 (GJA1) Antibodies
- Connexin 43/GJA1 (GJA1) (Gap Junction Protein, alpha 1, 43kDa (GJA1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Connexin 43/GJA1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GJA1 antibody was raised against the N terminal of GJA1
- Purification
- Affinity purified
- Immunogen
- GJA1 antibody was raised using the N terminal of GJA1 corresponding to a region with amino acids LYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVDMHLKQIEIKKFKYGIE
- Top Product
- Discover our top product GJA1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GJA1 Blocking Peptide, catalog no. 33R-5566, is also available for use as a blocking control in assays to test for specificity of this GJA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Connexin 43/GJA1 (GJA1) (Gap Junction Protein, alpha 1, 43kDa (GJA1))
- Alternative Name
- GJA1 (GJA1 Products)
- Synonyms
- AVSD3 antibody, CX43 antibody, DFNB38 antibody, GJAL antibody, HLHS1 antibody, HSS antibody, ODDD antibody, Cx43 antibody, AU042049 antibody, AW546267 antibody, Cnx43 antibody, Cx43alpha1 antibody, Gja-1 antibody, Npm1 antibody, connexin43 antibody, cx43a1 antibody, gja1 antibody, zfCx43.3 antibody, connexin 43 antibody, gja1-A antibody, cx43 antibody, gjal antibody, oddd antibody, dfnb38 antibody, gap junction protein alpha 1 antibody, gap junction protein, alpha 1 antibody, connexin 43 antibody, gap junction protein alpha 1 L homeolog antibody, CONNEXIN 43 protein antibody, GJA1 antibody, Gja1 antibody, cx43 antibody, gja1.L antibody, gja1 antibody, CONNEXIN 43 antibody
- Background
- Gap junction protein, alpha 1 is a member of the connexin gene family and a component of gap junctions. Gap junctions are composed of arrays of intercellular channels and provide a route for the diffusion of materials of low molecular weight from cell to cell. Connexin 43 is the major protein of gap junctions in the heart, and gap junctions are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development.
- Molecular Weight
- 42 kDa (MW of target protein)
- Pathways
- MAPK Signaling, Myometrial Relaxation and Contraction, Cell-Cell Junction Organization
-