IL-5 antibody
-
- Target See all IL-5 (IL5) Antibodies
- IL-5 (IL5) (Interleukin 5 (IL5))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IL-5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- IL5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL
- Top Product
- Discover our top product IL5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IL5 Blocking Peptide, catalog no. 33R-4928, is also available for use as a blocking control in assays to test for specificity of this IL5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IL-5 (IL5) (Interleukin 5 (IL5))
- Alternative Name
- IL5 (IL5 Products)
- Synonyms
- EDF antibody, IL-5 antibody, TRF antibody, Il-5 antibody, IL5 antibody, interleukin 5 antibody, IL5 antibody, Il5 antibody
- Background
- IL5 is a cytokine that acts as a growth and differentiation factor for both B cells and eosinophils. This cytokine is a main regulator of eosinopoiesis, eosinophil maturation and activation. The elevated production of this cytokine is reported to be related to asthma or hypereosinophilic syndromes.
- Molecular Weight
- 13 kDa (MW of target protein)
- Pathways
- JAK-STAT Signaling, Positive Regulation of Peptide Hormone Secretion, Production of Molecular Mediator of Immune Response, Feeding Behaviour
-