G6PC antibody (N-Term)

Catalog No. ABIN634831

Product Details anti-G6PC Antibody

Target: G6PC (Glucose 6-Phosphatase, Catalytic (G6PC))

Binding Specificity: N-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This G6PC antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: G6 PC antibody was raised against the N terminal of G6 C

Purification: Affinity purified

Immunogen: G6 PC antibody was raised using the N terminal of G6 C corresponding to a region with amino acids NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

G6PC Blocking Peptide, catalog no. 33R-6784, is also available for use as a blocking control in assays to test for specificity of this G6PC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of G0 C antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for G6PC

Target: G6PC (Glucose 6-Phosphatase, Catalytic (G6PC))

Alternative Name: G6PC (G6PC Products)

Synonyms: AW107337 antibody, G6Pase antibody, G6pt antibody, Glc-6-Pase antibody, G6PC1 antibody, G6PT antibody, GSD1 antibody, GSD1a antibody, G-6-Pase antibody, glucose-6-phosphatase, catalytic antibody, glucose-6-phosphatase catalytic subunit antibody, glucose-6-phosphatase, catalytic subunit antibody, G6pc antibody, G6PC antibody

Background: G6PC hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. It forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis, Cellular Glucan Metabolic Process