LAPTM4B antibody (Middle Region)

Catalog No. ABIN634891

Product Details anti-LAPTM4B Antibody

Target: LAPTM4B (Lysosomal Protein Transmembrane 4 beta (LAPTM4B))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LAPTM4B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LAPTM4 B antibody was raised against the middle region of LAPTM4

Purification: Affinity purified

Immunogen: LAPTM4 B antibody was raised using the middle region of LAPTM4 corresponding to a region with amino acids YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LAPTM4B Blocking Peptide, catalog no. 33R-10204, is also available for use as a blocking control in assays to test for specificity of this LAPTM4B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAPTM0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LAPTM4B

Target: LAPTM4B (Lysosomal Protein Transmembrane 4 beta (LAPTM4B))

Alternative Name: LAPTM4B (LAPTM4B Products)

Synonyms: LAPTM4beta antibody, LC27 antibody, C330023P13Rik antibody, lysosomal protein transmembrane 4 beta antibody, lysosomal-associated protein transmembrane 4B antibody, LAPTM4B antibody, Laptm4b antibody

Background: LAPTM4B is a multi-pass membrane protein. It belongs to the LAPTM4/LAPTM5 transporter family. LAPTM4b has active role in disease progression of malignant cells and is involved in cell proliferation and multidrug resistance. The genetic polymorphism of LAPTM4B is a potential risk factor for the development of colon cancer and gastric cancer. The research results also indicated that LAPTM4B may be a clinically useful prognostic indicator for ovarian carcinoma and may play a role in human hepatocellular carcinoma.

Molecular Weight: 35 kDa (MW of target protein)