LAPTM4B antibody (Middle Region)
-
- Target See all LAPTM4B Antibodies
- LAPTM4B (Lysosomal Protein Transmembrane 4 beta (LAPTM4B))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LAPTM4B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LAPTM4 B antibody was raised against the middle region of LAPTM4
- Purification
- Affinity purified
- Immunogen
- LAPTM4 B antibody was raised using the middle region of LAPTM4 corresponding to a region with amino acids YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS
- Top Product
- Discover our top product LAPTM4B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LAPTM4B Blocking Peptide, catalog no. 33R-10204, is also available for use as a blocking control in assays to test for specificity of this LAPTM4B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAPTM0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LAPTM4B (Lysosomal Protein Transmembrane 4 beta (LAPTM4B))
- Alternative Name
- LAPTM4B (LAPTM4B Products)
- Synonyms
- LAPTM4beta antibody, LC27 antibody, C330023P13Rik antibody, lysosomal protein transmembrane 4 beta antibody, lysosomal-associated protein transmembrane 4B antibody, LAPTM4B antibody, Laptm4b antibody
- Background
- LAPTM4B is a multi-pass membrane protein. It belongs to the LAPTM4/LAPTM5 transporter family. LAPTM4b has active role in disease progression of malignant cells and is involved in cell proliferation and multidrug resistance. The genetic polymorphism of LAPTM4B is a potential risk factor for the development of colon cancer and gastric cancer. The research results also indicated that LAPTM4B may be a clinically useful prognostic indicator for ovarian carcinoma and may play a role in human hepatocellular carcinoma.
- Molecular Weight
- 35 kDa (MW of target protein)
-