EBP antibody
-
- Target See all EBP Antibodies
- EBP (Emopamil Binding Protein (Sterol Isomerase) (EBP))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EBP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- EBP antibody was raised using a synthetic peptide corresponding to a region with amino acids LVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITA
- Top Product
- Discover our top product EBP Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EBP Blocking Peptide, catalog no. 33R-5513, is also available for use as a blocking control in assays to test for specificity of this EBP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EBP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EBP (Emopamil Binding Protein (Sterol Isomerase) (EBP))
- Alternative Name
- EBP (EBP Products)
- Synonyms
- cdpx2 antibody, cho2 antibody, cpx antibody, cpxd antibody, zgc:91895 antibody, CDPX2 antibody, CHO2 antibody, CPX antibody, CPXD antibody, AI255399 antibody, Pabp antibody, Td antibody, mSI antibody, emopamil binding protein (sterol isomerase) antibody, emopamil binding protein (sterol isomerase) L homeolog antibody, phenylalkylamine Ca2+ antagonist (emopamil) binding protein antibody, Ebp antibody, ebp.L antibody, ebp antibody, EBP antibody
- Background
- EBP is an integral membrane protein of the endoplasmic reticulum. It is a high affinity binding protein for the antiischemic phenylalkylamine Ca2+ antagonist [3H]emopamil and the photoaffinity label [3H]azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins in the endoplasmic reticulum of different tissues.
- Molecular Weight
- 26 kDa (MW of target protein)
-