ABCA5 antibody
-
- Target See all ABCA5 Antibodies
- ABCA5 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 5 (ABCA5))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ABCA5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ABCA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids HKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILGLLGPNGAGKSTIINI
- Top Product
- Discover our top product ABCA5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ABCA5 Blocking Peptide, catalog no. 33R-3759, is also available for use as a blocking control in assays to test for specificity of this ABCA5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCA5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ABCA5 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 5 (ABCA5))
- Alternative Name
- ABCA5 (ABCA5 Products)
- Synonyms
- zgc:163009 antibody, ABC13 antibody, EST90625 antibody, B930033A02Rik antibody, mKIAA1888 antibody, ATP binding cassette subfamily A member 5 antibody, ATP-binding cassette, sub-family A (ABC1), member 5 antibody, ATP-binding cassette sub-family A member 5 antibody, ABCA5 antibody, abca5 antibody, LOC100545445 antibody, Abca5 antibody
- Background
- The membrane-associated protein ABCA5 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). ABCA5 is a member of the ABC1 subfamily.
- Molecular Weight
- 186 kDa (MW of target protein)
-