ABCB1 antibody
-
- Target See all ABCB1 Antibodies
- ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ABCB1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ABCB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTQ
- Top Product
- Discover our top product ABCB1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ABCB1 Blocking Peptide, catalog no. 33R-1285, is also available for use as a blocking control in assays to test for specificity of this ABCB1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))
- Alternative Name
- ABCB1 (ABCB1 Products)
- Synonyms
- ABC20 antibody, CD243 antibody, CLCS antibody, GP170 antibody, MDR1 antibody, P-GP antibody, PGY1 antibody, Abcb1 antibody, Mdr1a antibody, p-gp antibody, xemdr antibody, Mdr1 antibody, Mdr1b antibody, Pgy-1 antibody, Pgy1 antibody, mdr antibody, ABCB1 antibody, PGP1 antibody, ATP binding cassette subfamily B member 1 antibody, ATP binding cassette subfamily B member 1A antibody, ATP binding cassette subfamily B member 1 L homeolog antibody, ATP-binding cassette, sub-family B (MDR/TAP), member 1B antibody, ABCB1 antibody, Abcb1a antibody, abcb1.L antibody, Abcb1b antibody, Abcb1 antibody
- Background
- The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes.
- Molecular Weight
- 141 kDa (MW of target protein)
-