CYP4V2 antibody (Middle Region)
-
- Target See all CYP4V2 Antibodies
- CYP4V2 (Cytochrome P450, Family 4, Subfamily V, Polypeptide 2 (CYP4V2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CYP4V2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CYP4 V2 antibody was raised against the middle region of CYP4 2
- Purification
- Affinity purified
- Immunogen
- CYP4 V2 antibody was raised using the middle region of CYP4 2 corresponding to a region with amino acids RYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI
- Top Product
- Discover our top product CYP4V2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CYP4V2 Blocking Peptide, catalog no. 33R-8274, is also available for use as a blocking control in assays to test for specificity of this CYP4V2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP4V2 (Cytochrome P450, Family 4, Subfamily V, Polypeptide 2 (CYP4V2))
- Alternative Name
- CYP4V2 (CYP4V2 Products)
- Synonyms
- BCD antibody, CYP4AH1 antibody, CYP4V antibody, bcd antibody, cyp4ah1 antibody, MGC147146 antibody, cytochrome P450 family 4 subfamily V member 2 antibody, cytochrome P450 family 4 subfamily V member 2 S homeolog antibody, cytochrome P450, family 4, subfamily V, polypeptide 2 antibody, cytochrome P450, family 4, subfamily v, polypeptide 2 antibody, CYP4V2 antibody, cyp4v2.S antibody, cyp4v2 antibody
- Background
- This gene encodes a member of the cytochrome P450 hemethiolate protein superfamily which are involved in oxidizing various substrates in the metabolic pathway. It is implicated in the metabolism of fatty acid precursors into n-3 polyunsaturated fatty acids. Mutations in this gene result in Bietti crystalline corneoretinal dystrophy.
- Molecular Weight
- 61 kDa (MW of target protein)
-