DENND1B antibody (Middle Region)
-
- Target See all DENND1B Antibodies
- DENND1B (DENN/MADD Domain Containing 1B (DENND1B))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DENND1B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DENND1 B antibody was raised against the middle region of DENND1
- Purification
- Affinity purified
- Immunogen
- DENND1 B antibody was raised using the middle region of DENND1 corresponding to a region with amino acids PVNLSVNQEIFIACEQVLKDQPALVPHSYFIAPDVTGLPTIPESRNLTEY
- Top Product
- Discover our top product DENND1B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DENND1B Blocking Peptide, catalog no. 33R-7416, is also available for use as a blocking control in assays to test for specificity of this DENND1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DENND0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DENND1B (DENN/MADD Domain Containing 1B (DENND1B))
- Alternative Name
- DENND1B (DENND1B Products)
- Synonyms
- C1ORF18 antibody, C1orf218 antibody, FAM31B antibody, 4632404N19Rik antibody, 4930467M19Rik antibody, 6820401H01Rik antibody, F730008N07Rik antibody, Fam31b antibody, si:ch211-195i21.1 antibody, DENN domain containing 1B antibody, DENN/MADD domain containing 1B antibody, DENND1B antibody, dennd1b antibody, Dennd1b antibody
- Background
- DENND1B contains 1 dDENN domain, 1 DENN domain and 1 uDENN domain. The function of the DENND1B protein remains unknown.
- Molecular Weight
- 45 kDa (MW of target protein)
-