NTRK3 antibody (C-Term)

Catalog No. ABIN635695

Product Details anti-NTRK3 Antibody

Target: NTRK3 (Neurotrophic tyrosine Kinase, Receptor, Type 3 (NTRK3))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NTRK3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NTRK3 antibody was raised against the C terminal of NTRK3

Purification: Affinity purified

Immunogen: NTRK3 antibody was raised using the C terminal of NTRK3 corresponding to a region with amino acids ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NTRK3 Blocking Peptide, catalog no. 33R-2709, is also available for use as a blocking control in assays to test for specificity of this NTRK3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NTRK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NTRK3

Target: NTRK3 (Neurotrophic tyrosine Kinase, Receptor, Type 3 (NTRK3))

Alternative Name: NTRK3 (NTRK3 Products)

Synonyms: TRKC antibody, gp145(trkC) antibody, trkC antibody, AW125844 antibody, Ntrk3_tv3 antibody, TrkC antibody, neurotrophic receptor tyrosine kinase 3 antibody, neurotrophic tyrosine kinase, receptor, type 3 antibody, NTRK3 antibody, Ntrk3 antibody

Background: NTRK3 is a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers.

Molecular Weight: 89 kDa (MW of target protein)

Pathways: RTK Signaling, Neurotrophin Signaling Pathway, Regulation of Cell Size