SLC27A2 antibody

Catalog No. ABIN635835

Product Details anti-SLC27A2 Antibody

Target: SLC27A2 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 2 (SLC27A2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC27A2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC27 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC27A2 Blocking Peptide, catalog no. 33R-5137, is also available for use as a blocking control in assays to test for specificity of this SLC27A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC27A2

Target: SLC27A2 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 2 (SLC27A2))

Alternative Name: SLC27A2 (SLC27A2 Products)

Synonyms: vlcs antibody, fatp2 antibody, vlacs antibody, acsvl1 antibody, facvl1 antibody, im:7139614 antibody, slc27a2 antibody, wu:fb99g05 antibody, zgc:112376 antibody, ACSVL1 antibody, FACVL1 antibody, HsT17226 antibody, hFACVL1 antibody, FATP2 antibody, VLCS antibody, Vlac antibody, Vlacs antibody, VLACS antibody, solute carrier family 27 (fatty acid transporter), member 2 L homeolog antibody, solute carrier family 27 member 2 antibody, solute carrier family 27 (fatty acid transporter), member 2a antibody, solute carrier family 27 (fatty acid transporter), member 2 antibody, slc27a2.L antibody, SLC27A2 antibody, slc27a2a antibody, slc27a2 antibody, Slc27a2 antibody

Background: SLC27A2 is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes, but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy.

Molecular Weight: 70 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process, SARS-CoV-2 Protein Interactome