ACVR1 antibody (N-Term)
-
- Target See all ACVR1 (ACRV1) Antibodies
- ACVR1 (ACRV1) (Activin Receptor Type I (ACRV1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACVR1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ACVR1 antibody was raised against the N terminal of ACVR1
- Purification
- Affinity purified
- Immunogen
- ACVR1 antibody was raised using the N terminal of ACVR1 corresponding to a region with amino acids EGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSP
- Top Product
- Discover our top product ACRV1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACVR1 Blocking Peptide, catalog no. 33R-2439, is also available for use as a blocking control in assays to test for specificity of this ACVR1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACVR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACVR1 (ACRV1) (Activin Receptor Type I (ACRV1))
- Alternative Name
- ACVR1 (ACRV1 Products)
- Synonyms
- ACTRI antibody, ACVR1A antibody, ACVRLK2 antibody, ALK2 antibody, FOP antibody, SKR1 antibody, TSRI antibody, ActR-IA antibody, ActR-I antibody, ActRIA antibody, Acvr antibody, Acvrlk2 antibody, Alk-2 antibody, Alk8 antibody, D330013D15Rik antibody, Tsk7L antibody, actri antibody, acvr1 antibody, acvr1-a antibody, acvr1-b antibody, acvr1a antibody, acvrlk2 antibody, alk-2 antibody, alk2 antibody, alk8 antibody, fop antibody, sax antibody, skr1 antibody, tsri antibody, xALK-2 antibody, activin A receptor type 1 antibody, activin A receptor, type 1 antibody, activin A receptor type 1 S homeolog antibody, ACVR1 antibody, Acvr1 antibody, acvr1.S antibody
- Background
- Activin receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. ACVR1 is activin A type I receptor which signals a particular transcriptional response in concert with activin type II receptors.
- Molecular Weight
- 55 kDa (MW of target protein)
-