anti-Human CYLD antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended CYLD Antibody (supplied by: Log in to see )

Antigen
Cylindromatosis (Turban Tumor Syndrome) (CYLD) Antibodies
  • BRSS
  • CDMT
  • CYLD1
  • CYLDI
  • EAC
  • MFT
  • MFT1
  • SBS
  • TEM
  • USPL2
  • 2010013M14Rik
  • 2900009M21Rik
  • C130039D01Rik
  • mKIAA0849
  • cyld
  • LRRGT00003
  • Rp1
  • Rp1h
  • CYLD lysine 63 deubiquitinase
  • cylindromatosis (turban tumor syndrome), a
  • CYLD
  • Cyld
  • cylda
Reactivity
Human
73
61
42
6
4
2
2
2
1
1
1
1
1
Host
Rabbit
62
20
12
Clonality
Polyclonal
Conjugate
This CYLD antibody is un-conjugated
4
3
3
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
66
35
20
14
13
11
9
4
3
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4301704
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
9.954848 ABIN4301701 ICC IF IHC IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN2854660 ICC IF IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN683833 IF (p) IHC (p) WB Rabbit IgG AA 390-440, pSer418 Log in to see Polyclonal 0
1 ABIN683842 IHC (p) WB HRP Rabbit IgG AA 390-440, pSer418 Log in to see Polyclonal 0
1 ABIN683835 IHC (p) WB Biotin Rabbit IgG AA 390-440, pSer418 Log in to see Polyclonal 0
1 ABIN750158 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen Cylindromatosis (Turban Tumor Syndrome) (CYLD) Antibodies
Reactivity Human
(73), (61), (42), (6), (4), (2), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(62), (20), (12)
Clonality
Polyclonal
Conjugate This CYLD antibody is un-conjugated
(4), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(66), (35), (20), (14), (13), (11), (9), (4), (3), (2), (1), (1)
Supplier Log in to see

Product Details anti-CYLD Antibody

Target Details CYLD Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: PPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFACVESTILLHINDIIPESVTQER
Isotype IgG
Plasmids, Primers & others

Target Details CYLD

Product Details anti-CYLD Antibody Application Details Handling Images back to top
Antigen
Alternative Name CYLD (CYLD Antibody Abstract)
Background Gene Symbol: CYLD
Gene ID 1540
UniProt Q9NQC7
Pathways Apoptosis, Activation of Innate immune Response

Application Details

Product Details anti-CYLD Antibody Target Details CYLD Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-CYLD Antibody Target Details CYLD Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-CYLD Antibody Target Details CYLD Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Cylindromatosis (Turban Tumor Syndrome) (CYLD) antibody (ABIN4301704) Immunocytochemistry/Immunofluorescence: CYLD Antibody [NBP2-33589] - Immunofluorescen...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Cylindromatosis (Turban Tumor Syndrome) (CYLD) antibody (ABIN4301704) Immunohistochemistry-Paraffin: CYLD Antibody [NBP2-33589] - Immunohistochemical stain...
Immunofluorescence (IF) image for anti-Cylindromatosis (Turban Tumor Syndrome) (CYLD) antibody (ABIN4301704) Immunocytochemistry/Immunofluorescence: CYLD Antibody - Staining of human cell line ...