anti-Human CD55 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended CD55 Antibody (supplied by: Log in to see )

Antigen
Complement Decay-Accelerating Factor (CD55) Antibodies
  • CR
  • CROM
  • DAF
  • TC
  • Daf
  • Daf-GPI
  • Daf1
  • GPI-DAF
  • CD55 molecule (Cromer blood group)
  • CD55 molecule, decay accelerating factor for complement
  • CD55
  • Cd55
Reactivity
Human
476
62
24
10
9
4
3
2
2
2
Host
Rabbit
389
110
24
10
8
3
3
Clonality
Polyclonal
Conjugate
This CD55 antibody is un-conjugated
56
51
33
17
13
11
11
11
10
10
6
6
6
6
6
5
5
5
5
5
5
4
4
4
3
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
414
199
120
101
74
70
43
39
14
8
6
6
6
5
3
2
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4294817
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.981754 ABIN291344 FACS IHC IHC (p) IP Mouse IgM Log in to see MEM-118 0
12.981754 ABIN731228 IF (p) IHC (p) WB Rabbit IgG AA 300-350 Log in to see Polyclonal 0
12.981754 ABIN4294818 ICC IF IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1027693 FACS IHC (p) IP PE Mouse IgM Domain SCR4 Log in to see MEM-118 6
1 ABIN94185 FACS IHC (p) IP FITC Mouse IgM Domain SCR4 Log in to see MEM-118 6
1 ABIN94184 FACS IHC (p) IP Biotin Mouse IgM Domain SCR4 Log in to see MEM-118 6
1 ABIN94183 FACS IHC (p) IP Mouse IgM Domain SCR4 Log in to see MEM-118 6
1 ABIN3043393 IHC (p) WB Rabbit IgG AA 35-347 Log in to see Polyclonal 0
1 ABIN573971 FACS IHC IHC (p) Mouse IgG1, kappa Log in to see 143-30 0
1 ABIN1995663 ELISA IHC (p) IP WB Rabbit IgG AA 1-353 Log in to see Polyclonal 0
1 ABIN2618672 ICC IHC IHC (p) WB Rabbit IgG AA 71-330 Log in to see Polyclonal 0
1 ABIN400664 EIA FACS IHC (p) WB Mouse IgM Log in to see MEM-118 0
1 ABIN5689937 ELISA IF IHC (p) WB Rabbit IgG AA 360-410 Log in to see Polyclonal 0
1 ABIN1724170 FACS IHC (p) IP Mouse IgM Log in to see MEM-118 0
1 ABIN600851 FACS IHC IHC (fro) IHC (p) Mouse IgG1 Log in to see 67 0
1 ABIN1724079 FACS IHC (p) Mouse IgG1 kappa Log in to see 143-30 0
1 ABIN269027 FACS IHC (p) IP IHC Mouse IgM Log in to see MEM-118 0
1 ABIN1814169 FACS IF IHC IHC (p) WB Rabbit AA 51-79 Log in to see Polyclonal 0
1 ABIN658718 FACS IF IHC (p) WB Rabbit Ig Fraction AA 51-79, N-Term Log in to see Polyclonal 0
1 ABIN5949826 FACS IHC IHC (p) Janelia Fluor® 549 Mouse IgM Log in to see MEM-118 0

General

Antigen Complement Decay-Accelerating Factor (CD55) Antibodies
Reactivity Human
(476), (62), (24), (10), (9), (4), (3), (2), (2), (2)
Host Rabbit
(389), (110), (24), (10), (8), (3), (3)
Clonality
Polyclonal
Conjugate This CD55 antibody is un-conjugated
(56), (51), (33), (17), (13), (11), (11), (11), (10), (10), (6), (6), (6), (6), (6), (5), (5), (5), (5), (5), (5), (4), (4), (4), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(414), (199), (120), (101), (74), (70), (43), (39), (14), (8), (6), (6), (6), (5), (3), (2), (1), (1), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-CD55 Antibody

Target Details CD55 Application Details Handling References for anti-CD55 antibody (ABIN4294817) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISF
Isotype IgG
Plasmids, Primers & others

Target Details CD55

Product Details anti-CD55 Antibody Application Details Handling References for anti-CD55 antibody (ABIN4294817) Images back to top
Antigen
Alternative Name CD55/DAF (CD55 Antibody Abstract)
Background Gene Symbol: CD55
Gene ID 1604
Pathways Complement System, Regulation of Leukocyte Mediated Immunity

Application Details

Product Details anti-CD55 Antibody Target Details CD55 Handling References for anti-CD55 antibody (ABIN4294817) Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-CD55 Antibody Target Details CD55 Application Details References for anti-CD55 antibody (ABIN4294817) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-CD55 antibody (ABIN4294817)

Product Details anti-CD55 Antibody Target Details CD55 Application Details Handling Images back to top
Product cited in:

Izuhara, Tatsumi, Miyagawa, Iwai, Watanabe, Yamanaka, Katsuoka, Nagashima, Okano, Yokoo: "Generation of a felinized Swine endothelial cell line by expression of feline decay-accelerating factor." in: PLoS ONE, Vol. 10, Issue 2, pp. e0117682, 2015 (Sample species: Cat (Feline)). Further details: Western Blotting,Immunohistochemistry

Images

Product Details anti-CD55 Antibody Target Details CD55 Application Details Handling References for anti-CD55 antibody (ABIN4294817) back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Complement Decay-Accelerating Factor (CD55) antibody (ABIN4294817) Immunohistochemistry: CD55/DAF Antibody [NBP1-85466] - Staining of human lung shows s...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Complement Decay-Accelerating Factor (CD55) antibody (ABIN4294817) Immunohistochemistry-Paraffin: CD55/DAF Antibody - Staining of human lung shows high...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Complement Decay-Accelerating Factor (CD55) antibody (ABIN4294817) Immunohistochemistry-Paraffin: CD55/DAF Antibody - Staining of human kidney shows lo...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Complement Decay-Accelerating Factor (CD55) antibody (ABIN4294817) Immunohistochemistry-Paraffin: CD55/DAF Antibody - Staining in human lung and kidney...