anti-Human ADCY5 antibody for Immunofluorescence

Recommended ADCY5 Antibody (supplied by: Log in to see )

Antigen
Adenylate Cyclase 5 (ADCY5) Antibodies
  • AC5
  • ADCY5
  • si:dkeyp-60a7.2
  • FDFM
  • AW121902
  • Ac5
  • RUT
  • adenylate cyclase 5
  • ADCY5
  • adcy5
  • Adcy5
Reactivity
Human
35
24
23
1
Host
Rabbit
31
6
Clonality
Polyclonal
Conjugate
This ADCY5 antibody is un-conjugated
2
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF)
18
13
13
10
6
4
3
2
2
2
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5074869
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
10.57752 ABIN5572035 ELISA IF IHC (p) Rabbit Log in to see Polyclonal 0
1 ABIN498295 IF IHC (p) WB Rabbit Log in to see Polyclonal 0

General

Antigen Adenylate Cyclase 5 (ADCY5) Antibodies
Reactivity Human
(35), (24), (23), (1)
Host Rabbit
(31), (6)
Clonality
Polyclonal
Conjugate This ADCY5 antibody is un-conjugated
(2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(18), (13), (13), (10), (6), (4), (3), (2), (2), (2)
Supplier Log in to see

Product Details anti-ADCY5 Antibody

Target Details ADCY5 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:('FTCNSRDLLGCLAQEHNISASQVNACHVAESAVNYSLGDEQGFCGSPWPNCNF',)
Isotype IgG
Plasmids, Primers & others

Target Details ADCY5

Product Details anti-ADCY5 Antibody Application Details Handling Images back to top
Antigen
Alternative Name Adenylate Cyclase 5 (ADCY5 Antibody Abstract)
Background Gene Symbol: ADCY5
Gene ID 111
Pathways EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Thyroid Hormone Synthesis, cAMP Metabolic Process, Myometrial Relaxation and Contraction, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma

Application Details

Product Details anti-ADCY5 Antibody Target Details ADCY5 Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-ADCY5 Antibody Target Details ADCY5 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-ADCY5 Antibody Target Details ADCY5 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Adenylate Cyclase 5 (ADCY5) antibody (ABIN5074869) Immunocytochemistry/Immunofluorescence: Adenylate Cyclase 5 Antibody - Staining of h...
Immunofluorescence (fixed cells) (IF/ICC) image for anti-Adenylate Cyclase 5 (ADCY5) antibody (ABIN5074869) Immunocytochemistry/Immunofluorescence: Adenylate Cyclase 5 Antibody - Staining of h...