anti-Human LARS antibody for Immunofluorescence

Recommended LARS Antibody (supplied by: Log in to see )

Antigen
Leucyl-tRNA Synthetase (LARS) Antibodies
  • HSPC192
  • LARS1
  • LEURS
  • LEUS
  • LRS
  • PIG44
  • RNTLS
  • hr025Cl
  • CG7479
  • Dmel\\CG7479
  • LeuRS
  • F21M12.1
  • F21M12_1
  • BA4991
  • DDBDRAFT_0183834
  • DDBDRAFT_0231251
  • DDB_0183834
  • DDB_0231251
  • 2310045K21Rik
  • 3110009L02Rik
  • AW536573
  • mKIAA1352
  • leucyl-tRNA synthetase
  • Leucyl-tRNA synthetase, mitochondrial
  • ATP binding/leucine-tRNA ligases/aminoacyl-tRNA ligase
  • leucine--tRNA ligase
  • leucyl-tRNA synthetase LeuS
  • leucyl-tRNA ligase
  • leucine-tRNA ligase
  • LARS
  • LeuRS-m
  • AT1G09620
  • leuS
  • APH_RS02290
  • mleuS
  • Lars
Reactivity
Human
24
15
6
2
1
1
1
1
1
1
Host
Rabbit
27
Clonality
Polyclonal
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
27
12
7
5
5
4
3
3
2
2
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4330336
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
10.579316 ABIN4330335 ICC IF IHC IHC (p) WB Rabbit Log in to see Polyclonal 0
1 ABIN5698061 ELISA IF IHC IP WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1088111 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2145584 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen Leucyl-tRNA Synthetase (LARS) Antibodies
Reactivity Human
(24), (15), (6), (2), (1), (1), (1), (1), (1), (1)
Host Rabbit
(27)
Clonality
Polyclonal
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(27), (12), (7), (5), (5), (4), (3), (3), (2), (2)
Supplier Log in to see

Product Details anti-LARS Antibody

Target Details LARS Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EHWLDYFPPLAIQDLKRMGLKVDWRRSFITTDVNPYYDSFVRWQFLTLRERNKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQEYTLLKLKVL
Isotype IgG
Plasmids, Primers & others

Target Details LARS

Product Details anti-LARS Antibody Application Details Handling Images back to top
Antigen
Alternative Name LARS (LARS Antibody Abstract)
Background Gene Symbol: LARS
Gene ID 51520
Pathways EGFR Signaling Pathway

Application Details

Product Details anti-LARS Antibody Target Details LARS Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-LARS Antibody Target Details LARS Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-LARS Antibody Target Details LARS Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Leucyl-tRNA Synthetase (LARS) antibody (ABIN4330336) Immunocytochemistry/Immunofluorescence: LARS Antibody [NBP1-90430] - Staining of huma...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Leucyl-tRNA Synthetase (LARS) antibody (ABIN4330336) Immunohistochemistry-Paraffin: LARS Antibody [NBP1-90430] - Staining of human liver s...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Leucyl-tRNA Synthetase (LARS) antibody (ABIN4330336) Immunohistochemistry-Paraffin: LARS Antibody - Staining of human urinary bladder sho...