anti-Mouse (Murine) SRA1 antibody for ELISA

Recommended SRA1 Antibody (supplied by: Log in to see )

Steroid Receptor RNA Activator 1 (SRA1) Antibodies
  • SRA
  • SRAP
  • STRAA1
  • pp7684
  • AA959952
  • Sra
  • Srap
  • Straa1
  • Strra1
  • zgc:86613
  • P140SRA-1
  • SHYC
  • SRA1
  • steroid receptor RNA activator 1
  • steroid receptor RNA activator 1 S homeolog
  • cytoplasmic FMR1 interacting protein 1
  • SRA1
  • Sra1
  • sra1
  • sra1.S
  • CYFIP1
AA 519-556
Human, Rat (Rattus), Mouse (Murine)
This SRA1 antibody is un-conjugated
Immunoprecipitation (IP), ELISA, Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN1742561
$ 487.03
Plus shipping costs $45.00


Antigen Steroid Receptor RNA Activator 1 (SRA1) Antibodies
Epitope AA 519-556
(10), (10), (7), (3), (2), (2), (2), (1), (1)
Reactivity Human, Rat (Rattus), Mouse (Murine)
(64), (5), (5), (4), (4), (4), (3), (2), (2)
Host Mouse
(39), (24)
Clonality (Clone)
Monoclonal   ( )
Conjugate This SRA1 antibody is un-conjugated
(2), (2), (2), (2), (2), (2)
Application Immunoprecipitation (IP), ELISA, Western Blotting (WB)
(64), (45), (25), (10), (2), (1), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-SRA1 Antibody

Target Details SRA1 Application Details Handling References for anti-SRA1 antibody (ABIN1742561) Images
Specificity Specific for Sra 1
Cross-Reactivity (Details) may cross-react with CYFIP 2/PIR 121 due to high sequence homology.
Purification purified IgG. Azide was added before lyophilization.
Immunogen Synthetic peptide CDWETGHEPFNDPALRGEKDPKSGFDIKVPRRAVGPSS (aa 519-556 in mouse Sra 1b) coupled to key-hole limpet hemocyanin via an internal N-terminal cysteine residue.
Clone 30A4
Isotype IgG1
Plasmids, Primers & others

Target Details SRA1

Product Details anti-SRA1 Antibody Application Details Handling References for anti-SRA1 antibody (ABIN1742561) Images back to top
Alternative Name Sra 1 (SRA1 Antibody Abstract)
Background Synonyms: CYFIP 1
Pathways EGFR Signaling Pathway, Stem Cell Maintenance, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development

Application Details

Product Details anti-SRA1 Antibody Target Details SRA1 Handling References for anti-SRA1 antibody (ABIN1742561) Images back to top
Application Notes WB: 1 : 100 up to 1 : 2000 (AP staining)
Restrictions For Research Use only


Product Details anti-SRA1 Antibody Target Details SRA1 Application Details References for anti-SRA1 antibody (ABIN1742561) Images back to top
Format Lyophilized
Reconstitution For reconstitution add 100 µL H2O to get a 1mg/ml solution of antibody in PBS. Then aliquot and store at -20 °C until use.
Buffer PBS, 0.02% sodium azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Do not store diluted antibody solutions unless you add detergent or carrier proteins such as goat serum, BSA or others. IgG sticks to glass and plastic. Any IgG solution below 0.1 mg/mL protein will quickly adsorb and denature and thus loose activity! Repetitive freeze-thawing of dilute purified IgG is almost certain to lead to substantial losses.
Storage -20 °C
Storage Comment Unlabeled antibodies are stable in this form without loss of quality at ambient temperatures for several weeks or even months. They can be stored at 4 °C for several years.

References for anti-SRA1 antibody (ABIN1742561)

Product Details anti-SRA1 Antibody Target Details SRA1 Application Details Handling Images back to top
Product cited in:

Bozdagi, Sakurai, Dorr, Pilorge, Takahashi, Buxbaum: "Haploinsufficiency of Cyfip1 produces fragile X-like phenotypes in mice." in: PLoS ONE, Vol. 7, Issue 8, pp. e42422, 2012

Steffen, Faix, Resch, Linkner, Wehland, Small, Rottner, Stradal: "Filopodia formation in the absence of functional WAVE- and Arp2/3-complexes." in: Molecular biology of the cell, Vol. 17, Issue 6, pp. 2581-91, 2006


Product Details anti-SRA1 Antibody Target Details SRA1 Application Details Handling References for anti-SRA1 antibody (ABIN1742561) back to top
Supplier Images
Western Blotting (WB) image for anti-Steroid Receptor RNA Activator 1 (SRA1) (AA 519-556) antibody (ABIN1742561) anti-Steroid Receptor RNA Activator 1 (SRA1) (AA 519-556) antibody