anti-Human Serotonin Receptor 2B antibody for Immunohistochemistry

Recommended Serotonin Receptor 2B Antibody (supplied by: Log in to see )

Serotonin Receptor 2B (HTR2B) Antibodies
  • 5-HT2B
  • 5HT2B
  • 5htr2b
  • HTR2B
  • 5ht2b
  • zgc:194094
  • zgc:194119
  • AJ012488
  • AV377389
  • 5-HT(2B)
  • 5-hydroxytryptamine receptor 2B
  • 5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled
  • 5-hydroxytryptamine (serotonin) receptor 2B
  • HTR2B
  • htr2b
  • Htr2b
This Serotonin Receptor 2B antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4276881
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.47117 ABIN1534243 IF IHC ELISA WB Rabbit IgG AA 261-310 Log in to see Polyclonal 0
8.47117 ABIN2879284 ELISA IF IHC IHC (p) WB Rabbit IgG AA 15-64 Log in to see Polyclonal 0
8.47117 ABIN1048266 IHC IHC (p) Rabbit Extracellular Domain Log in to see Polyclonal 0
8.47117 ABIN1048268 IHC IHC (p) Rabbit N-Term Log in to see Polyclonal 0
8.47117 ABIN1048267 IHC IHC (p) Rabbit Cytoplasmic Domain Log in to see Polyclonal 0
8.47117 ABIN5962832 IHC WB Rabbit IgG Log in to see Polyclonal 0
8.47117 ABIN6256878 ELISA ICC IF IHC WB Rabbit IgG Log in to see Polyclonal 0
8.47117 ABIN2421129 IHC ELISA Rabbit IgG Log in to see Polyclonal 0
1 ABIN2889845 ELISA IF IHC IHC (p) WB Rabbit IgG AA 261-310 Log in to see Polyclonal 0
1 ABIN1876871 IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2976164 IF/ICC IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1454115 IHC ELISA WB Rabbit IgG AA 233-282 Log in to see Polyclonal 0
1 ABIN6262416 ELISA ICC IF IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2884776 IHC ELISA WB Rabbit IgG AA 233-282 Log in to see Polyclonal 0
1 ABIN2881212 IF IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1873110 IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2286735 IHC Rabbit 2nd Extracellular Domain Log in to see Polyclonal 0
1 ABIN2286732 IHC Rabbit 2nd Extracellular Domain Log in to see Polyclonal 0
1 ABIN2286734 IHC Rabbit N-Term Log in to see Polyclonal 0
1 ABIN2697509 IHC WB Rabbit IgG Log in to see Polyclonal 0


Antigen Serotonin Receptor 2B (HTR2B) Antibodies
Reactivity Human
(106), (25), (23), (3), (2), (2), (2), (2), (1), (1)
Host Rabbit
(104), (4)
Conjugate This Serotonin Receptor 2B antibody is un-conjugated
(2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(61), (33), (28), (28), (23), (22), (7), (5), (4), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-Serotonin Receptor 2B Antibody

Target Details Serotonin Receptor 2B Application Details Handling References for anti-Serotonin Receptor 2B antibody (ABIN4276881) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVL
Isotype IgG
Plasmids, Primers & others

Target Details Serotonin Receptor 2B

Product Details anti-Serotonin Receptor 2B Antibody Application Details Handling References for anti-Serotonin Receptor 2B antibody (ABIN4276881) Images back to top
Alternative Name 5-HT2B (HTR2B Antibody Abstract)
Background Gene Symbol: HTR2B
Gene ID 3357
Pathways JAK-STAT Signaling, Inositol Metabolic Process, Regulation of G-Protein Coupled Receptor Protein Signaling, Regulation of Carbohydrate Metabolic Process

Application Details

Product Details anti-Serotonin Receptor 2B Antibody Target Details Serotonin Receptor 2B Handling References for anti-Serotonin Receptor 2B antibody (ABIN4276881) Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200Immunohistochemistry retrieval recommended: HIER pH 6

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-Serotonin Receptor 2B Antibody Target Details Serotonin Receptor 2B Application Details References for anti-Serotonin Receptor 2B antibody (ABIN4276881) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-Serotonin Receptor 2B antibody (ABIN4276881)

Product Details anti-Serotonin Receptor 2B Antibody Target Details Serotonin Receptor 2B Application Details Handling Images back to top
Product cited in:

De Sousa E Melo, Wang, Jansen, Fessler, Trinh, de Rooij, de Jong, de Boer, van Leersum, Bijlsma, Rodermond, van der Heijden, van Noesel, Tuynman, Dekker, Markowetz, Medema, Vermeulen: "Poor-prognosis colon cancer is defined by a molecularly distinct subtype and develops from serrated precursor lesions." in: Nature medicine, Vol. 19, Issue 5, pp. 614-8, 2013


Product Details anti-Serotonin Receptor 2B Antibody Target Details Serotonin Receptor 2B Application Details Handling References for anti-Serotonin Receptor 2B antibody (ABIN4276881) back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Serotonin Receptor 2B (HTR2B) antibody (ABIN4276881) Immunohistochemistry: 5-HT2B Antibody [NBP1-90322] - Immunohistochemical staining of ...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Serotonin Receptor 2B (HTR2B) antibody (ABIN4276881) Immunohistochemistry-Paraffin: 5-HT2B Antibody - Staining of human endometrium shows...
Immunofluorescence (IF) image for anti-Serotonin Receptor 2B (HTR2B) antibody (ABIN4276881) Immunocytochemistry/Immunofluorescence: 5-HT2B Antibody - Immunofluorescent staining...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Serotonin Receptor 2B (HTR2B) antibody (ABIN4276881) Immunohistochemistry-Paraffin: 5-HT2B Antibody - Staining of human skeletal muscle s...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Serotonin Receptor 2B (HTR2B) antibody (ABIN4276881) Immunohistochemistry-Paraffin: 5-HT2B Antibody - Staining of human kidney shows mode...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Serotonin Receptor 2B (HTR2B) antibody (ABIN4276881) Immunohistochemistry-Paraffin: 5-HT2B Antibody - Staining of human endometrium shows...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Serotonin Receptor 2B (HTR2B) antibody (ABIN4276881) Immunohistochemistry-Paraffin: 5-HT2B Antibody - Staining of human placenta shows mo...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Serotonin Receptor 2B (HTR2B) antibody (ABIN4276881) Immunohistochemistry-Paraffin: 5-HT2B Antibody - Staining in human endometrium and s...