anti-Human SOCS5 antibody for Immunofluorescence

Recommended SOCS5 Antibody (supplied by: Log in to see )

Antigen
Suppressor of Cytokine Signaling 5 (SOCS5) Antibodies
  • SOCS5
  • cis6
  • cish5
  • cish6
  • socs-5
  • GB18949
  • socs5
  • zgc:153506
  • CIS6
  • CISH6
  • Cish5
  • SOCS-5
  • 1810018L08Rik
  • mKIAA0671
  • RGD1564914
  • suppressor of cytokine signaling 5
  • suppressor of cytokine signaling 5a
  • suppressor of cytokine signaling 5 L homeolog
  • SOCS5
  • socs5
  • LOC552036
  • socs5a
  • Tsp_07018
  • socs5.L
  • Socs5
Reactivity
Human
72
36
26
2
2
1
1
1
1
1
Host
Rabbit
49
15
8
Clonality
Polyclonal
Conjugate
This SOCS5 antibody is un-conjugated
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
53
33
14
13
11
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4355059
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN5698413 ELISA IF WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen Suppressor of Cytokine Signaling 5 (SOCS5) Antibodies
Reactivity Human
(72), (36), (26), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(49), (15), (8)
Clonality
Polyclonal
Conjugate This SOCS5 antibody is un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(53), (33), (14), (13), (11), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-SOCS5 Antibody

Target Details SOCS5 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HLIKQHTAPVSPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLGPKLAPGMTEISGDSSAIPQANCDSEEDTTTLCLQSRRQKQRQISGDSHTHVSRQGAWKVHTQI
Isotype IgG
Plasmids, Primers & others

Target Details SOCS5

Product Details anti-SOCS5 Antibody Application Details Handling Images back to top
Antigen
Alternative Name SOCS-5 (SOCS5 Antibody Abstract)
Background Gene Symbol: SOCS5
Gene ID 9655
Pathways JAK-STAT Signaling, EGFR Signaling Pathway, Positive Regulation of Immune Effector Process

Application Details

Product Details anti-SOCS5 Antibody Target Details SOCS5 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-SOCS5 Antibody Target Details SOCS5 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-SOCS5 Antibody Target Details SOCS5 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Suppressor of Cytokine Signaling 5 (SOCS5) antibody (ABIN4355059) Immunocytochemistry/Immunofluorescence: SOCS-5 Antibody [NBP1-85608] - Immunofluoresc...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Suppressor of Cytokine Signaling 5 (SOCS5) antibody (ABIN4355059) Immunohistochemistry-Paraffin: SOCS-5 Antibody [NBP1-85608] - Staining of human prost...
Immunofluorescence (IF) image for anti-Suppressor of Cytokine Signaling 5 (SOCS5) antibody (ABIN4355059) Immunocytochemistry/Immunofluorescence: SOCS-5 Antibody - Staining of human cell lin...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Suppressor of Cytokine Signaling 5 (SOCS5) antibody (ABIN4355059) Immunohistochemistry-Paraffin: SOCS-5 Antibody - Staining of human endometrium shows...
Immunofluorescence (fixed cells) (IF/ICC) image for anti-Suppressor of Cytokine Signaling 5 (SOCS5) antibody (ABIN4355059) Immunocytochemistry/Immunofluorescence: SOCS-5 Antibody - Staining of human cell lin...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Suppressor of Cytokine Signaling 5 (SOCS5) antibody (ABIN4355059) Immunohistochemistry-Paraffin: SOCS-5 Antibody - Staining of human endometrium shows...