anti-Mouse (Murine) Tumor Necrosis Factor antibody for Immunochromatography

Recommended Tumor Necrosis Factor Antibody (supplied by: Log in to see )

Antigen
Tumor Necrosis Factor (TNF) Antibodies
  • DIF
  • TNF-alpha
  • TNFA
  • TNFSF2
  • RATTNF
  • Tnfa
  • tnf
  • TNF-a
  • TNFalpha
  • Tnfsf1a
  • TNFa
  • cTNF
  • Tnf-alpha
  • tnfa-like
  • TNF-ALPHA
  • dif
  • tnfa
  • xtnf
  • tnfsf2
  • tnf-alpha
  • Cachectin
  • tumor necrosis factor
  • tumor necrosis factor b (TNF superfamily, member 2)
  • tumor necrosis factor alpha
  • tumor necrosis factor a (TNF superfamily, member 2)
  • TNF
  • Tnf
  • tnf
  • tnfb
  • tnf-alpha
  • LOC103694380
  • tnfa
Epitope
AA 80-235
97
70
51
49
26
22
19
15
14
10
10
8
8
7
6
4
4
4
3
3
3
3
2
2
2
2
1
1
1
1
1
1
1
Reactivity
Mouse (Murine)
1381
529
459
229
223
203
202
59
56
44
32
18
15
9
7
6
6
5
4
4
4
4
3
2
2
1
1
1
1
Host
Rabbit
1071
543
138
52
11
10
8
7
5
2
1
Clonality
Polyclonal
Conjugate
This Tumor Necrosis Factor antibody is un-conjugated
185
95
71
55
49
26
23
22
21
20
19
19
19
19
19
19
18
17
11
11
11
11
11
11
11
11
11
11
11
11
11
11
11
4
4
3
2
2
2
2
2
2
2
2
2
2
2
2
2
1
1
1
Application
Immunochromatography (IC), Immunohistochemistry (IHC), ELISA, Western Blotting (WB)
830
806
756
468
405
269
206
170
134
120
100
67
48
42
26
26
25
17
15
13
9
9
9
7
6
6
5
5
5
3
3
3
3
2
2
2
2
2
2
2
2
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Catalog No. ABIN2380185
$ 540.57
Plus shipping costs $45.00

General

Antigen Tumor Necrosis Factor (TNF) Antibodies
Epitope AA 80-235
(97), (70), (51), (49), (26), (22), (19), (15), (14), (10), (10), (8), (8), (7), (6), (4), (4), (4), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity Mouse (Murine)
(1381), (529), (459), (229), (223), (203), (202), (59), (56), (44), (32), (18), (15), (9), (7), (6), (6), (5), (4), (4), (4), (4), (3), (2), (2), (1), (1), (1), (1)
Host Rabbit
(1071), (543), (138), (52), (11), (10), (8), (7), (5), (2), (1)
Clonality
Polyclonal
Conjugate This Tumor Necrosis Factor antibody is un-conjugated
(185), (95), (71), (55), (49), (26), (23), (22), (21), (20), (19), (19), (19), (19), (19), (19), (18), (17), (11), (11), (11), (11), (11), (11), (11), (11), (11), (11), (11), (11), (11), (11), (11), (4), (4), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Application Immunochromatography (IC), Immunohistochemistry (IHC), ELISA, Western Blotting (WB)
(830), (806), (756), (468), (405), (269), (206), (170), (134), (120), (100), (67), (48), (42), (26), (26), (25), (17), (15), (13), (9), (9), (9), (7), (6), (6), (5), (5), (5), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-Tumor Necrosis Factor Antibody

Target Details Tumor Necrosis Factor Application Details Handling Images
Sequence MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGSEF-LRSSSQNSSD K PVAHVVANHQ VEEQLEWLSQ RANALLANGM DLKDNQLVVP ADGLYLVYSQ VLFKGQGCPD YVLLTHTVSR FAISYQEKVN LLSAVKSPCP KDTPEGAELK PWYEPIYLGG VFQLEKGDQL SAEVNLPKYL DFAESGQVYF GVIAL
Cross-Reactivity Mouse (Murine)
Cross-Reactivity (Details) Calculated cross reactivity: Mo
Characteristics Tumor Necrosis Factor Alpha (TNFa)
Purification Purified by immunoaffinity chromatography.
Immunogen TNFa (Leu80~Leu235), MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-L RSSSQNSSDK PVAHVVANHQ VEEQLEWLSQ RANALLANGM DLKDNQLVVP ADGLYLVYSQ VLFKGQGCPD YVLLTHTVSR FAISYQEKVN LLSAVKSPCP KDTPEGAELK PWYEPIYLGG VFQLEKGDQL SAEVNLPKYL DFAESGQVYF GVIAL
Isotype IgG
Plasmids, Primers & others

Target Details Tumor Necrosis Factor

Product Details anti-Tumor Necrosis Factor Antibody Application Details Handling Images back to top
Antigen
Alternative Name Tumor Necrosis Factor alpha (TNF Antibody Abstract)
Pathways NF-kappaB Signaling, Apoptosis, Caspase Cascade in Apoptosis, Cellular Response to Molecule of Bacterial Origin, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Positive Regulation of Endopeptidase Activity, Hepatitis C, Protein targeting to Nucleus

Application Details

Product Details anti-Tumor Necrosis Factor Antibody Target Details Tumor Necrosis Factor Handling Images back to top
Application Notes Optimal working conditions should be determined by the investigator.
Restrictions For Research Use only

Handling

Product Details anti-Tumor Necrosis Factor Antibody Target Details Tumor Necrosis Factor Application Details Images back to top
Format Liquid
Buffer Supplied as a liquid in PBS, pH 7.2, 0.05 % sodium azide, 50 % glycerol.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment -20°C