anti-Human EXOC1 antibody for Immunofluorescence

Recommended EXOC1 Antibody (supplied by: Log in to see )

Antigen
Exocyst Complex Component 1 (EXOC1) Antibodies
  • CG3885
  • Dmel\\CG3885
  • Sec3
  • sec3l1
  • zgc:64145
  • wu:fb58e03
  • SEC3L1
  • MGC165876
  • DKFZp459K086
  • BM-102
  • SEC3
  • SEC3P
  • 2810407P21Rik
  • A730011E05Rik
  • Sec3l1
  • Sec3p
  • Secretory 3
  • exocyst complex component 1
  • Exocyst complex component 1
  • Sec3
  • LOC475149
  • exoc1
  • EXOC1
  • LOC582238
  • LOC100566235
  • Exoc1
  • sec-3
Reactivity
Human
19
12
9
6
6
5
5
4
4
2
2
2
2
2
2
Host
Rabbit
18
1
Clonality
Polyclonal
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
16
6
6
5
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4352411
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.155504 ABIN5079554 ICC IF Rabbit IgG Log in to see Polyclonal 0

General

Antigen Exocyst Complex Component 1 (EXOC1) Antibodies
Reactivity Human
(19), (12), (9), (6), (6), (5), (5), (4), (4), (2), (2), (2), (2), (2), (2)
Host Rabbit
(18), (1)
Clonality
Polyclonal
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(16), (6), (6), (5), (1), (1), (1)
Supplier Log in to see

Product Details anti-EXOC1 Antibody

Target Details EXOC1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FKLQQHQSMPGTMAEAEDLDGGTLSRQHNCGTPLPVSSEKDMIRQMMIKIFRCIEPELNNLIALGDKIDSFNSLYMLVKMSHHVWTA
Isotype IgG
Plasmids, Primers & others

Target Details EXOC1

Product Details anti-EXOC1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name SEC3 (EXOC1 Antibody Abstract)
Background Gene Symbol: EXOC1
Gene ID 55763
Pathways Peptide Hormone Metabolism, Synaptic Vesicle Exocytosis

Application Details

Product Details anti-EXOC1 Antibody Target Details EXOC1 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-EXOC1 Antibody Target Details EXOC1 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-EXOC1 Antibody Target Details EXOC1 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Exocyst Complex Component 1 (EXOC1) antibody (ABIN4352411) Immunocytochemistry/Immunofluorescence: SEC3 Antibody [NBP1-89957] - Staining of huma...
Western Blotting (WB) image for anti-Exocyst Complex Component 1 (EXOC1) antibody (ABIN4352411) Western Blot: SEC3 Antibody [NBP1-89957] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Exocyst Complex Component 1 (EXOC1) antibody (ABIN4352411) Immunohistochemistry-Paraffin: SEC3 Antibody [NBP1-89957] - Staining of human testis ...