anti-Dog (Canine) YWHAZ antibody for Western Blotting

Recommended YWHAZ Antibody (supplied by: Log in to see )

Antigen
tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) Antibodies
  • 14-3-3-zeta
  • KCIP-1
  • YWHAD
  • 14-3-3zeta
  • Ywhaz
  • ACYPI003154
  • 14-3-3z
  • kcip-1
  • ywhaq
  • 1433z
  • ywhaz
  • ywhazb
  • 1110013I11Rik
  • AI596267
  • AL022924
  • AU020854
  • ywhaza
  • fb14h09
  • wu:fb05g08
  • wu:fb14h09
  • ywhai
  • zgc:55807
  • 14-3-3
  • 14-3-3 zeta
  • 14-3-3ZETA
  • 14-3-3leo
  • 2G1
  • 4-3-3 zeta
  • 5.11
  • 549
  • BEST:GH05075
  • CG17870
  • D14-3-3
  • D14-3-3zeta
  • Dmel\\CG17870
  • K
  • LEO
  • Leo
  • PAR-5
  • PAR5
  • Par-5
  • d14-3-3zeta
  • l(2)07103
  • l(2)46CFe
  • l(2)46Ee
  • leo
  • par-5
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta
  • 14-3-3 protein zeta
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta L homeolog
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta S homeolog
  • 14-3-3 protein zeta/delta pseudogene
  • CG17870 gene product from transcript CG17870-RE
  • YWHAZ
  • 14-3-3zeta
  • ywhaz
  • 1433z
  • ywhaz.L
  • Ywhaz
  • ywhaz.S
  • LOC100855903
Epitope
C-Term
53
13
11
11
11
10
10
8
7
7
5
4
4
3
3
3
3
3
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
238
169
133
29
24
21
20
14
7
7
6
6
4
4
3
3
2
2
1
Host
Rabbit
228
13
Clonality
Polyclonal
Conjugate
This YWHAZ antibody is un-conjugated
7
6
5
3
3
3
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
219
126
88
64
61
24
15
13
12
7
3
3
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN629824
$ 388.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
10 ABIN1491173 IHC IHC (p) WB Rabbit AA 200-245 Log in to see Polyclonal 0
7.8002124 ABIN2783207 IHC WB Rabbit Middle Region Log in to see Polyclonal 1
7 ABIN768945 IHC IHC (p) WB Rabbit C-Term Log in to see Polyclonal 0
7 ABIN960408 IHC IHC (p) WB Rabbit AA 50-100 Log in to see Polyclonal 0
4.8002124 ABIN2783206 WB Rabbit C-Term Log in to see Polyclonal 1
4.8002124 ABIN2463127 ELISA WB Rabbit Log in to see Polyclonal 0
4 ABIN321366 WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN609110 ELISA IHC IHC (p) WB Rabbit IgG AA 1-10 Log in to see Polyclonal 0
1 ABIN1731317 IHC (p) WB Rabbit IgG AA 200-245 Log in to see Polyclonal 0
1 ABIN600345 IHC WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) Antibodies
Epitope C-Term
(53), (13), (11), (11), (11), (10), (10), (8), (7), (7), (5), (4), (4), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
(238), (169), (133), (29), (24), (21), (20), (14), (7), (7), (6), (6), (4), (4), (3), (3), (2), (2), (1)
Host Rabbit
(228), (13)
Clonality
Polyclonal
Conjugate This YWHAZ antibody is un-conjugated
(7), (6), (5), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(219), (126), (88), (64), (61), (24), (15), (13), (12), (7), (3), (3)
Supplier Log in to see

Product Details anti-YWHAZ Antibody

Target Details YWHAZ Application Details Handling Images
Specificity YWHAZ antibody was raised against the C terminal of YWHAZ
Purification Purified
Immunogen YWHAZ antibody was raised using the C terminal of YWHAZ corresponding to a region with amino acids AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGE
Plasmids, Primers & others

Target Details YWHAZ

Product Details anti-YWHAZ Antibody Application Details Handling Images back to top
Antigen
Alternative Name YWHAZ (YWHAZ Antibody Abstract)
Background YWHAZ belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity.
Molecular Weight 28 kDa (MW of target protein)
Pathways Apoptosis, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location

Application Details

Product Details anti-YWHAZ Antibody Target Details YWHAZ Handling Images back to top
Application Notes WB: 5 µg/mL
Optimal conditions should be determined by the investigator.
Comment

YWHAZ Blocking Peptide, catalog no. 33R-1158, is also available for use as a blocking control in assays to test for specificity of this YWHAZ antibody

Restrictions For Research Use only

Handling

Product Details anti-YWHAZ Antibody Target Details YWHAZ Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YWHAZ antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product Details anti-YWHAZ Antibody Target Details YWHAZ Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) (C-Term) antibody (ABIN629824) YWHAZ antibody used at 5 ug/ml to detect target protein.