anti-Mouse (Murine) Methionyl Aminopeptidase 2 antibody for Western Blotting

Recommended Methionyl Aminopeptidase 2 Antibody (supplied by: Log in to see )

Antigen
Methionyl Aminopeptidase 2 (METAP2) Antibodies
  • metap2
  • MGC53792
  • METAP2
  • GB13458
  • DDBDRAFT_0190923
  • DDBDRAFT_0304991
  • DDB_0190923
  • DDB_0304991
  • 4930584B20Rik
  • A930035J23Rik
  • AI047573
  • AL024412
  • AU014659
  • Amp2
  • Mnpep
  • p67
  • p67eIF2
  • MAP2
  • MNPEP
  • wu:fb98h06
  • zgc:66250
  • methionyl aminopeptidase 2 L homeolog
  • methionyl aminopeptidase 2
  • methionine aminopeptidase 2
  • methionine aminopeptidase
  • methionyl aminopeptidase 2 S homeolog
  • methionyl aminopeptidase 2b
  • metap2.L
  • METAP2
  • metap2
  • LOC551771
  • CAALFM_C604080WA
  • Metap2
  • metap2.S
  • metap2b
Epitope
N-Term
22
11
10
10
9
7
7
6
5
4
2
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
91
16
8
2
2
2
2
2
1
1
1
1
1
Host
Rabbit
85
9
2
Clonality
Polyclonal
Conjugate
Un-conjugated
7
7
7
6
6
6
Application
Western Blotting (WB)
85
60
29
12
8
6
4
2
2
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN631470
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
7.8063846 ABIN2784850 IHC WB Rabbit N-Term Log in to see Polyclonal 1
7.8063846 ABIN2001079 ELISA IHC (p) IP WB Rabbit IgG AA 2-478 Log in to see Polyclonal 0
7 ABIN958392 IHC IHC (p) WB Rabbit IgG AA 95-144 Log in to see Polyclonal 0
4.8063846 ABIN4904354 WB Rabbit IgG Log in to see Polyclonal 0
4.8063846 ABIN2463504 ELISA WB Rabbit Log in to see Polyclonal 0
4.8063846 ABIN5996053 WB Rabbit IgG Log in to see Polyclonal 0
4.8063846 ABIN2692624 IP WB Rabbit IgG AA 2-478 Log in to see 010 0
4.8063846 ABIN6570213 WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN5661334 WB Rabbit Log in to see Polyclonal 0
1 ABIN5700075 ELISA IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2914681 ELISA IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1088565 IHC ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN5892289 ELISA IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN6033184 IF/ICC IHC IP WB Rabbit Log in to see Polyclonal 0

General

Antigen Methionyl Aminopeptidase 2 (METAP2) Antibodies
Epitope N-Term
(22), (11), (10), (10), (9), (7), (7), (6), (5), (4), (2), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(91), (16), (8), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(85), (9), (2)
Clonality
Polyclonal
Conjugate Un-conjugated
(7), (7), (7), (6), (6), (6)
Application Western Blotting (WB)
(85), (60), (29), (12), (8), (6), (4), (2), (2)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Specificity METAP2 antibody was raised against the N terminal of METAP2
Purification Affinity purified
Immunogen METAP2 antibody was raised using the N terminal of METAP2 corresponding to a region with amino acids ATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGR

Target Details

Product details Application Details Handling Images back to top
Antigen
Alternative Name METAP2 (METAP2 Antibody Abstract)
Background METAP2 is a member of the methionyl aminopeptidase family and encodes a protein that binds 2 cobalt or manganese ions. This protein functions both by protecting the alpha subunit of eukaryotic initiation factor 2 from inhibitory phosphorylation and by removing the amino-terminal methionine residue from nascent protein. Increased expression of this gene is associated with various forms of cancer and the anti-cancer drugs fumagillin and ovalicin inhibit the protein by irreversibly binding to its active site.
Molecular Weight 53 kDa (MW of target protein)
Pathways Regulation of G-Protein Coupled Receptor Protein Signaling

Application Details

Product details Target Details Handling Images back to top
Application Notes WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.
Comment

METAP2 Blocking Peptide, catalog no. 33R-1556, is also available for use as a blocking control in assays to test for specificity of this METAP2 antibody

Restrictions For Research Use only

Handling

Product details Target Details Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METAP2 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product details Target Details Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Methionyl Aminopeptidase 2 (METAP2) (N-Term) antibody (ABIN631470) METAP2 antibody used at 0.5 ug/ml to detect target protein.