anti-Human BMP6 antibody for Immunofluorescence

Recommended BMP6 Antibody (supplied by: Log in to see )

Bone Morphogenetic Protein 6 (BMP6) Antibodies
  • BMP6
  • zgc:113595
  • vgr
  • vgr-1
  • vgr1
  • VGR
  • VGR1
  • D13Wsu115e
  • Vgr1
  • bone morphogenetic protein 6
  • bone morphogenetic protein 6 S homeolog
  • BMP6
  • bmp6
  • bmp6.S
  • Bmp6
This BMP6 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5075308
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1173353 ICC IF IHC WB FITC Rabbit IgG Log in to see Polyclonal 0


Antigen Bone Morphogenetic Protein 6 (BMP6) Antibodies
Reactivity Human
(101), (23), (17), (3), (2), (2), (2), (2), (2), (2), (2), (1)
Host Rabbit
(86), (27)
Conjugate This BMP6 antibody is un-conjugated
(12), (9), (6), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(96), (70), (29), (17), (3), (2), (2), (2), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-BMP6 Antibody

Target Details BMP6 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELY
Isotype IgG

Target Details BMP6

Product Details anti-BMP6 Antibody Application Details Handling Images back to top
Alternative Name BMP-6 (BMP6 Antibody Abstract)
Background Gene Symbol: BMP6
Gene ID 654
Pathways Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process

Application Details

Product Details anti-BMP6 Antibody Target Details BMP6 Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-BMP6 Antibody Target Details BMP6 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-BMP6 Antibody Target Details BMP6 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Bone Morphogenetic Protein 6 (BMP6) antibody (ABIN5075308) Immunocytochemistry/Immunofluorescence: BMP-6 Antibody - Staining of human cell line...