anti-Rat (Rattus) MIF antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended MIF Antibody (supplied by: Log in to see )

Antigen
Macrophage Migration Inhibitory Factor (Glycosylation-Inhibiting Factor) (MIF) Antibodies
  • mif
  • Mif
  • gif
  • glif
  • mmif
  • LOC100136498
  • LOC100284350
  • LOC100284546
  • GIF
  • Glif
  • GLIF
  • MMIF
  • macrophage migration inhibitory factor L homeolog
  • macrophage migration inhibitory factor
  • macrophage migration inhibitory factor (glycosylation-inhibiting factor)
  • mif.L
  • mif
  • MIF
  • Mif
  • PHATRDRAFT_49660
  • LOC100136498
  • cl405_1
  • LOC100284546
Reactivity
Human, Mouse (Murine), Rat (Rattus)
180
62
61
7
6
5
4
3
2
2
2
1
1
Host
Rabbit
107
61
28
16
4
1
Clonality
Polyclonal
Conjugate
This MIF antibody is un-conjugated
17
10
6
4
4
4
4
3
3
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
170
115
40
33
30
19
12
12
9
5
4
3
1
1
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4334481
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.824656 ABIN736836 IF (p) IHC (p) Rabbit IgG AA 67-88 Log in to see Polyclonal 0
12.824656 ABIN1108247 IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN3044495 IHC (p) WB Rabbit IgG AA 98-115, C-Term Log in to see Polyclonal 0
1 ABIN372861 EIA IHC (p) WB Goat IgG C-Term Log in to see Polyclonal 0
1 ABIN1493110 IHC (p) WB Rabbit C-Term Log in to see Polyclonal 0
1 ABIN601894 IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN1736947 IHC (p) ELISA WB Goat C-Term Log in to see Polyclonal 0
1 ABIN1493111 IHC (p) IP WB Magnetic Particles Rabbit C-Term Log in to see Polyclonal 0
1 ABIN1493112 IHC (p) IP WB Sepharose Rabbit C-Term Log in to see Polyclonal 0
1 ABIN3031673 IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN1689908 IHC (p) WB Rabbit Log in to see Polyclonal 0

General

Antigen Macrophage Migration Inhibitory Factor (Glycosylation-Inhibiting Factor) (MIF) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(180), (62), (61), (7), (6), (5), (4), (3), (2), (2), (2), (1), (1)
Host Rabbit
(107), (61), (28), (16), (4), (1)
Clonality
Polyclonal
Conjugate This MIF antibody is un-conjugated
(17), (10), (6), (4), (4), (4), (4), (3), (3), (3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(170), (115), (40), (33), (30), (19), (12), (12), (9), (5), (4), (3), (1), (1), (1), (1), (1), (1), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-MIF Antibody

Target Details MIF Application Details Handling References for anti-MIF antibody (ABIN4334481) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNN
Isotype IgG

Target Details MIF

Product Details anti-MIF Antibody Application Details Handling References for anti-MIF antibody (ABIN4334481) Images back to top
Antigen
Alternative Name MIF (MIF Antibody Abstract)
Background Gene Symbol: MIF
Gene ID 4282
Pathways Regulation of Systemic Arterial Blood Pressure by Hormones, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Smooth Muscle Cell Migration, Negative Regulation of intrinsic apoptotic Signaling

Application Details

Product Details anti-MIF Antibody Target Details MIF Handling References for anti-MIF antibody (ABIN4334481) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500-1:1000For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-MIF Antibody Target Details MIF Application Details References for anti-MIF antibody (ABIN4334481) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-MIF antibody (ABIN4334481)

Product Details anti-MIF Antibody Target Details MIF Application Details Handling Images back to top
Product cited in:

Põlajeva, Bergström, Edqvist, Lundequist, Sjösten, Nilsson, Smits, Bergqvist, Pontén, Westermark, Pejler, Forsberg Nilsson, Tchougounova: "Glioma-derived macrophage migration inhibitory factor (MIF) promotes mast cell recruitment in a STAT5-dependent manner." in: Molecular oncology, Vol. 8, Issue 1, pp. 50-8, 2014

Ma, Visser, Roelofsen, de Vries, Diepstra, van Imhoff, van der Wal, Luinge, Alvarez-Llamas, Vos, Poppema, Vonk, van den Berg: "Proteomics analysis of Hodgkin lymphoma: identification of new players involved in the cross-talk between HRS cells and infiltrating lymphocytes." in: Blood, Vol. 111, Issue 4, pp. 2339-46, 2008

Images

Product Details anti-MIF Antibody Target Details MIF Application Details Handling References for anti-MIF antibody (ABIN4334481) back to top
Supplier Images
Western Blotting (WB) image for anti-Macrophage Migration Inhibitory Factor (Glycosylation-Inhibiting Factor) (MIF) antibody (ABIN4334481) Western Blot: MIF Antibody [NBP1-81832] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, ...
Immunofluorescence (IF) image for anti-Macrophage Migration Inhibitory Factor (Glycosylation-Inhibiting Factor) (MIF) antibody (ABIN4334481) Immunocytochemistry/Immunofluorescence: MIF Antibody [NBP1-81832] - Staining of human...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Macrophage Migration Inhibitory Factor (Glycosylation-Inhibiting Factor) (MIF) antibody (ABIN4334481) Immunohistochemistry-Paraffin: MIF Antibody [NBP1-81832] - Staining of human prostate...
Western Blotting (WB) image for anti-Macrophage Migration Inhibitory Factor (Glycosylation-Inhibiting Factor) (MIF) antibody (ABIN4334481) Western Blot: MIF Antibody [NBP1-81832] - Lane 1: NIH-3T3 cell lysate (Mouse embryoni...
Western Blotting (WB) image for anti-Macrophage Migration Inhibitory Factor (Glycosylation-Inhibiting Factor) (MIF) antibody (ABIN4334481) Western Blot: MIF Antibody - Western blot analysis in mouse cell line NIH-3T3, rat c...
Immunofluorescence (IF) image for anti-Macrophage Migration Inhibitory Factor (Glycosylation-Inhibiting Factor) (MIF) antibody (ABIN4334481) Immunocytochemistry/Immunofluorescence: MIF Antibody - Immunofluorescent staining of...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Macrophage Migration Inhibitory Factor (Glycosylation-Inhibiting Factor) (MIF) antibody (ABIN4334481) Immunohistochemistry-Paraffin: MIF Antibody - Staining of human kidney shows cytopla...
Western Blotting (WB) image for anti-Macrophage Migration Inhibitory Factor (Glycosylation-Inhibiting Factor) (MIF) antibody (ABIN4334481) Western Blot: MIF Antibody - Analysis in human cell lines HEK293 and U-251MG using A...