anti-Rat (Rattus) Argininosuccinate Lyase antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Argininosuccinate Lyase Antibody (supplied by: Log in to see )

Antigen
Argininosuccinate Lyase (ASL) Antibodies
  • ASAL
  • 2510006M18Rik
  • zgc:63532
  • BA4879
  • PSPTO0125
  • argininosuccinate lyase
  • argininosuccinate lyase ArgH
  • argininosuccinate lyase L homeolog
  • ASL
  • Asl
  • asl
  • argH2
  • argH
  • arg7
  • CNC04420
  • STHERM_c13370
  • asl.L
Reactivity
Human, Mouse (Murine), Rat (Rattus)
57
34
27
6
6
6
6
6
5
4
3
3
3
3
3
3
2
Host
Rabbit
46
11
Clonality
Polyclonal
Conjugate
Un-conjugated
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
38
13
12
9
8
7
7
4
2
2
1
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Catalog No. ABIN5518971
$ 280.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1712111 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal 0
1 ABIN1701094 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal 0
1 ABIN1714596 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen Argininosuccinate Lyase (ASL) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(57), (34), (27), (6), (6), (6), (6), (6), (5), (4), (3), (3), (3), (3), (3), (3), (2)
Host Rabbit
(46), (11)
Clonality
Polyclonal
Conjugate Un-conjugated
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(38), (13), (12), (9), (8), (7), (7), (4), (2), (2), (1), (1), (1), (1)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Purpose Rabbit IgG polyclonal antibody for Adenylosuccinate Lyase detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Sequence YTHLQRAQPI RWSHWILSHA VALTRDSERL LEVRKRIN
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Adenylosuccinate Lyase detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: argininosuccinate lyase
Protein Name: Argininosuccinate lyase
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence of human Adenylosuccinate Lyase (YTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRIN).
Isotype IgG

Target Details

Product details Application Details Handling Images back to top
Antigen
Alternative Name ASL (ASL Antibody Abstract)
Background ASL (argininosuccinatelyase, also known as argininosuccinase) is an enzyme that catalyzes the reversible breakdown of argininosuccinate (ASA) producing the amino acid arginine and dicarboxylic acid fumarate. Located in liver cytosol, ASL is the fourth enzyme of the urea cycle and involved in the biosynthesis of arginine in all species and the production of urea in ureotelic species. Mutations in ASL, resulting low activity of the enzyme, increase levels of urea in the body and result in various side effects. The ASL gene is located on chromosome 7 between the centromere (junction of the long and short arm) and the long (q) arm at position 11.2, from base pair 64,984,963 to base pair 65,002,090.

Synonyms: Argininosuccinate lyase, ASAL, Arginosuccinase, ASL
Gene ID 435
UniProt P04424
Pathways Response to Growth Hormone Stimulus

Application Details

Product details Target Details Handling Images back to top
Application Notes Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Comment

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Restrictions For Research Use only

Handling

Product details Target Details Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.