anti-Human PDGFC antibody for Immunohistochemistry (Paraffin-embedded Sections)
Recommended PDGFC Antibody (supplied by: Log in to see )
- Antigen
-
Platelet-Derived Growth Factor C (PDGFC) Antibodies
show synonyms for this antigen- SCDGF
- FALLOTEIN
- 1110064L01Rik
- AI647969
- PDGF-C
- platelet derived growth factor C
- platelet-derived growth factor, C polypeptide
- PDGFC
- Pdgfc
- Reactivity
-
Human
Alternatives - Host
-
Rabbit
Alternatives - Clonality
- Conjugate
-
This PDGFC antibody is un-conjugated
Alternatives - Application
-
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Alternatives - Supplier
- Log in to see
- Supplier Product No.
- Log in to see
Get this product for free
Submit your validation data for this product and get a full refund. I want to validate this productAvailable images
Catalog No. ABIN4344542
Contact our Customer Service for availability and price in your country.
| Relevance Score | ABIN | Application | Conjugate | Host | Isotype | Epitope | Supplier | Clonality | References | Details |
|---|---|---|---|---|---|---|---|---|---|---|
| 1 | ABIN650654 | IHC (p) WB | Rabbit | Ig Fraction | AA 74-103, N-Term | Log in to see | Polyclonal | 1 | ||
| 1 | ABIN714566 | IF (p) IHC (p) WB | Rabbit | IgG | AA 240-290 | Log in to see | Polyclonal | 1 | ||
| 1 | ABIN5534633 | IHC (p) WB | Rabbit | Ig Fraction | AA 74-103, N-Term | Log in to see | Polyclonal | 0 | ||
| 1 | ABIN714575 | IHC (p) WB | HRP | Rabbit | IgG | AA 240-290 | Log in to see | Polyclonal | 0 | |
| 1 | ABIN714568 | IHC (p) WB | Biotin | Rabbit | IgG | AA 240-290 | Log in to see | Polyclonal | 0 | |
| 1 | ABIN4902108 | ELISA IHC (p) | Rabbit | IgG | Log in to see | Polyclonal | 0 | |||
| 1 | ABIN5679800 | ELISA IHC (p) WB | Rabbit | Log in to see | Polyclonal | 0 | ||||
| 1 | ABIN5585411 | IF IHC (p) | Rabbit | IgG | Log in to see | Polyclonal | 0 |
General |
|
|---|---|
| Antigen | Platelet-Derived Growth Factor C (PDGFC) Antibodies |
| Reactivity | Human Alternatives |
| Host | Rabbit Alternatives |
| Clonality | |
| Conjugate | This PDGFC antibody is un-conjugated Alternatives |
| Application |
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Alternatives
|
| Supplier | Log in to see |
Product Details anti-PDGFC AntibodyTarget Details PDGFC Application Details Handling Images |
|
| Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Purification | Immunogen affinity purified |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVLQLRPKTGVRGLHKSLTDVA |
| Isotype | IgG |
Target Details PDGFCProduct Details anti-PDGFC Antibody Application Details Handling Images back to top |
|
| Antigen | |
| Alternative Name | PDGF-C (PDGFC Antibody Abstract) |
| Background | Gene Symbol: PDGFC |
| Gene ID | 56034 |
| Pathways | RTK Signaling, Platelet-derived growth Factor Receptor Signaling |
Application DetailsProduct Details anti-PDGFC Antibody Target Details PDGFC Handling Images back to top |
|
| Application Notes | Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200HIER pH 6 retrieval is recommended. |
| Comment |
The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo. |
| Restrictions | For Research Use only |
HandlingProduct Details anti-PDGFC Antibody Target Details PDGFC Application Details Images back to top |
|
| Format | Liquid |
| Buffer |
PBS ( pH 7.2) and 40 % Glycerol Buffer contains: 0.02 % Sodium Azide |
| Preservative | Sodium azide |
| Precaution of Use | This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Storage | 4 °C,-20 °C |
| Storage Comment | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
ImagesProduct Details anti-PDGFC Antibody Target Details PDGFC Application Details Handling back to top |
|
| Supplier Images |
Immunocytochemistry/Immunofluorescence: PDGFC Antibody [NBP1-83935] - Staining of hum...
Immunohistochemistry-Paraffin: PDGFC Antibody [NBP1-83935] - Staining of human colon ...
Immunocytochemistry/Immunofluorescence: PDGF-C Antibody - Immunofluorescent staining...
|
