anti-Mouse (Murine) RYK antibody for Immunofluorescence

Recommended RYK Antibody (supplied by: Log in to see )

RYK Receptor-Like Tyrosine Kinase (RYK) Antibodies
  • RYK
  • jtk5
  • ryk1
  • jtk5a
  • d3s3195
  • wu:fb37b12
  • wu:fi05b06
  • zgc:158381
  • MGC114645
  • D3S3195
  • JTK5
  • JTK5A
  • RYK1
  • AW536699
  • ERK-3
  • Vik
  • receptor-like tyrosine kinase
  • receptor-like tyrosine kinase S homeolog
  • tyrosine-protein kinase RYK
  • RYK
  • ryk
  • ryk.S
  • LOC100541106
  • Ryk
Human, Mouse (Murine), Rat (Rattus)
This RYK antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5950545
Contact our Customer Service for availability and price in your country.


Antigen RYK Receptor-Like Tyrosine Kinase (RYK) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(106), (77), (59), (3), (2), (2), (1), (1), (1), (1)
Host Rabbit
(109), (24), (11), (5)
Conjugate This RYK antibody is un-conjugated
(11), (11), (10), (10), (10), (10), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(143), (70), (39), (9), (4), (3), (3), (2), (1), (1)
Supplier Log in to see

Product Details anti-RYK Antibody

Target Details RYK Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Protein A purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LWELMTLGQTPYVDIDPFEMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKFQQLVQCLTEFHAALG
Isotype IgG
Plasmids, Primers & others

Target Details RYK

Product Details anti-RYK Antibody Application Details Handling Images back to top
Alternative Name Ryk (RYK Antibody Abstract)
Background Gene Symbol: RYK
Gene ID 6259
Pathways RTK Signaling, WNT Signaling, Regulation of Cell Size

Application Details

Product Details anti-RYK Antibody Target Details RYK Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1 - 4 μg/mLRecommended conditions: Fixation/Permeabilization: PFA/Triton X-100

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-RYK Antibody Target Details RYK Application Details Images back to top
Format Liquid
Buffer PBS,  pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-RYK Antibody Target Details RYK Application Details Handling back to top
Supplier Images
Immunofluorescence (fixed cells) (IF/ICC) image for anti-RYK Receptor-Like Tyrosine Kinase (RYK) antibody (ABIN5950545) Immunocytochemistry/Immunofluorescence: Ryk Antibody - Staining of human cell line U...