anti-Human TECTA antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended TECTA Antibody (supplied by: Log in to see )

Tectorin alpha (TECTA) Antibodies
  • DFNA12
  • DFNA8
  • DFNB21
  • Tctna
  • tectorin alpha
  • Tecta
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4358355
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN5518790 IHC (p) WB Rabbit IgG AA 93-134, N-Term Log in to see Polyclonal 0
1 ABIN5647724 IHC (p) WB Rabbit IgG AA 93-134 Log in to see Polyclonal 0


Antigen Tectorin alpha (TECTA) Antibodies
Reactivity Human
(8), (2), (2)
Host Rabbit
(5), (3)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(7), (5), (2), (1), (1)
Supplier Log in to see

Product Details anti-TECTA Antibody

Target Details TECTA Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VLHTFDGASYAFPSEFSYTLLKTCPERPEYLEIDINKKKPDAGPAWLRGLRILVADQEVKIGGIGASEVKLNGQE
Isotype IgG

Target Details TECTA

Product Details anti-TECTA Antibody Application Details Handling Images back to top
Alternative Name Tectorin alpha (TECTA Antibody Abstract)
Background Gene Symbol: TECTA
Gene ID 7007
Pathways Sensory Perception of Sound

Application Details

Product Details anti-TECTA Antibody Target Details TECTA Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-TECTA Antibody Target Details TECTA Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-TECTA Antibody Target Details TECTA Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Tectorin alpha (TECTA) antibody (ABIN4358355) Immunohistochemistry-Paraffin: Tectorin alpha Antibody - Staining of human testis sh...