anti-Rat (Rattus) RFC2 antibody for Immunofluorescence

Recommended RFC2 Antibody

Antigen
Replication Factor C (Activator 1) 2, 40kDa (RFC2) Antibodies
  • 2610008M13Rik
  • 40kDa
  • AI326953
  • Recc2
  • RFC40
  • replication factor C subunit 2
  • replication factor C (activator 1) 2
  • LOC100231971
  • RFC2
  • Rfc2
Reactivity
Human, Mouse (Murine), Rat (Rattus)
91
40
39
7
4
4
4
3
3
3
1
1
Host
Rabbit
70
20
1
Clonality
Polyclonal
Conjugate
This RFC2 antibody is un-conjugated
3
3
3
3
3
3
3
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
62
17
15
13
13
10
7
2
1
Options

Available images

Catalog No. ABIN4350214
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Clonality References Details
4 ABIN6259175 ELISA ICC IF WB Rabbit IgG Polyclonal 0

General

Antigen Replication Factor C (Activator 1) 2, 40kDa (RFC2) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(91), (40), (39), (7), (4), (4), (4), (3), (3), (3), (1), (1)
Host Rabbit
(70), (20), (1)
Clonality
Polyclonal
Conjugate This RFC2 antibody is un-conjugated
(3), (3), (3), (3), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(62), (17), (15), (13), (13), (10), (7), (2), (1)
Supplier

Product Details anti-RFC2 Antibody

Target Details RFC2 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PAPAFSKAPGSAGHYELPWVEKYRPVKLNEIVGNEDTVSRLEVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPALKDAMLELNASND
Isotype IgG
Plasmids, Primers & others

Target Details RFC2

Product Details anti-RFC2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name RFC2 (RFC2 Antibody Abstract)
Background Gene Symbol: RFC2
Gene ID 5982
Pathways Telomere Maintenance, DNA Damage Repair, DNA Replication, Synthesis of DNA

Application Details

Product Details anti-RFC2 Antibody Target Details RFC2 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-RFC2 Antibody Target Details RFC2 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-RFC2 Antibody Target Details RFC2 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Replication Factor C (Activator 1) 2, 40kDa (RFC2) antibody (ABIN4350214) Western Blot: RFC2 Antibody [NBP1-89341] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Immunofluorescence (IF) image for anti-Replication Factor C (Activator 1) 2, 40kDa (RFC2) antibody (ABIN4350214) Immunocytochemistry/Immunofluorescence: RFC2 Antibody [NBP1-89341] - Staining of huma...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Replication Factor C (Activator 1) 2, 40kDa (RFC2) antibody (ABIN4350214) Immunohistochemistry-Paraffin: RFC2 Antibody [NBP1-89341] - Staining of human vulva/a...
Western Blotting (WB) image for anti-Replication Factor C (Activator 1) 2, 40kDa (RFC2) antibody (ABIN4350214) Western Blot: RFC2 Antibody [NBP1-89341] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...
Immunofluorescence (IF) image for anti-Replication Factor C (Activator 1) 2, 40kDa (RFC2) antibody (ABIN4350214) Immunocytochemistry/Immunofluorescence: RFC2 Antibody - Immunofluorescent staining o...