anti-Human Iodotyrosine Deiodinase antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Iodotyrosine Deiodinase Antibody (supplied by: Log in to see )

Iodotyrosine Deiodinase (IYD) Antibodies
  • MGC85450
  • C6orf71
  • DEHAL1
  • TDH4
  • dJ422F24.1
  • 0610009A07Rik
  • AI265638
  • Dehal1
  • RGD1309288
  • IYD-1
  • iodotyrosine deiodinase
  • iodotyrosine deiodinase L homeolog
  • IYD
  • iyd.L
  • iyd
  • Iyd
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4327802
Contact our Customer Service for availability and price in your country.


Antigen Iodotyrosine Deiodinase (IYD) Antibodies
Reactivity Human
(13), (4), (3), (1), (1), (1)
Host Rabbit
(14), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(15), (9), (4)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: ADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENVEHIPFSHNHYPEK
Isotype IgG

Target Details

Product details Application Details Handling Images back to top
Alternative Name IYD (IYD Antibody Abstract)
Background Gene Symbol: IYD
Gene ID 389434
UniProt Q6PHW0
Pathways Thyroid Hormone Synthesis

Application Details

Product details Target Details Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product details Target Details Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product details Target Details Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Iodotyrosine Deiodinase (IYD) antibody (ABIN4327802) Immunohistochemistry: IYD Antibody [NBP2-31786] - thyroid gland
Immunohistochemistry (IHC) image for anti-Iodotyrosine Deiodinase (IYD) antibody (ABIN4327802) Immunohistochemistry: IYD Antibody [NBP2-31786] - thyroid cancer
Immunohistochemistry (IHC) image for anti-Iodotyrosine Deiodinase (IYD) antibody (ABIN4327802) Immunohistochemistry: IYD Antibody [NBP2-31786] - Immunohistochemical staining of hum...
Immunohistochemistry (IHC) image for anti-Iodotyrosine Deiodinase (IYD) antibody (ABIN4327802) Immunohistochemistry: IYD Antibody [NBP2-31786] - thyroid cancer
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Iodotyrosine Deiodinase (IYD) antibody (ABIN4327802) Immunohistochemistry-Paraffin: IYD Antibody - Staining of human thyroid gland shows ...
Immunofluorescence (IF) image for anti-Iodotyrosine Deiodinase (IYD) antibody (ABIN4327802) Immunocytochemistry/Immunofluorescence: IYD Antibody - Staining of human cell line C...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Iodotyrosine Deiodinase (IYD) antibody (ABIN4327802) Immunohistochemistry-Paraffin: IYD Antibody - Staining of human cerebral cortex show...
Western Blotting (WB) image for anti-Iodotyrosine Deiodinase (IYD) antibody (ABIN4327802) Western Blot: IYD Antibody - Staining in human thyroid gland and cerebral cortex tis...